SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385778138|ref|YP_005687303.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385778138|ref|YP_005687303.1|
Domain Number 1 Region: 52-135
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 9.55e-27
Family Copper amine oxidase, domain N 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385778138|ref|YP_005687303.1|
Sequence length 267
Comment copper amine oxidase-like domain-containing protein [Clostridium thermocellum DSM 1313]
Sequence
MKKVALVLAIVSVFIMLVSVAEAAIELPLRVEVNGERVYFPDEQPFIDSNGRTQVPARFI
AEKLGANVTWDGKEKKAVFEKGSKKLVLYIGKAEYELNGEQKKMDTAALLISGRTFVPAR
YVAEAFDAKVSWDPDIRTVYINTNSKPSGKKEGTEIVAGFEVPLDTNLLAVETTWGGKTE
ACFEINLLRADVEGQIEDLRQILLQKCDSSTVDEVIAYVSQKKERKYYLPSKYIYDNKSK
RYIWIKESFMEDINVFYCSASYKRSEE
Download sequence
Identical sequences WP_003519477.1.19387 WP_003519477.1.20586 WP_003519477.1.6636 WP_003519477.1.6965 gi|385778138|ref|YP_005687303.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]