SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385778228|ref|YP_005687393.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385778228|ref|YP_005687393.1|
Domain Number 1 Region: 45-128
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 7.45e-26
Family Copper amine oxidase, domain N 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385778228|ref|YP_005687393.1|
Sequence length 262
Comment copper amine oxidase-like domain-containing protein [Clostridium thermocellum DSM 1313]
Sequence
MLTVFALTILFSNITFAINIPLRVLVNGEELYFPDEKPFIDANGRTQTPARFIGEALGAT
VTWDANAKKAVFKMDGTTLELFIGEREYQLNGQKKQMDTEALLINGRTFVPARYVAEAFG
ATVRWKDEIKTVYIDANKTDKVEDEDDTREVAGFIVPKDTDLMVAASKDDTSYEVVFTIG
FLKKDVEKQKDDMEKILLQKFSEETVKEIMSVVRSKVKDTDVIEARYFYDKKADQYMYMP
KSWPIRGSTITLYIYRKGDKPF
Download sequence
Identical sequences A3DF77
203119.Cthe_1374 gi|385778228|ref|YP_005687393.1| gi|125973889|ref|YP_001037799.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]