SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385778243|ref|YP_005687408.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385778243|ref|YP_005687408.1|
Domain Number 1 Region: 69-249
Classification Level Classification E-value
Superfamily SGNH hydrolase 3.83e-24
Family TAP-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385778243|ref|YP_005687408.1|
Sequence length 392
Comment hypothetical protein Clo1313_0889 [Clostridium thermocellum DSM 1313]
Sequence
MWKNAIYLFSSILIASLVILISGRYLDGISGSYLGEQKQRLEVQTEYQTELEKVQAGNVY
EKLVNKKEISVLIIGDDIAQGGLETEDEKKWYNLLAKRIKEEYGADLTCKNIATPGGTAF
DGWIDYITDRERQEYDLVFLCFGANDEREMNFNQKVFGAIAEGLIRNIKKAKASTEIITI
IENSIRSQSYVDTLKQVSEYYEITYADIIKAFIDSRLPFNDITEDGRKPNEQGYSIYVNT
IFDLIKSNINSKREPGFDGKKPLLYEESNAFENGKITTEFLTIQGFYNSVVAFDKIFMKS
SHSNDSITYEVSNSHMLGVTLMAGPNCGIVDIYLNNRLIQTYDCYAPYEALRHVLISDNI
GMGTHKIRIEVSSIKNAKASNSNVYIHGIITN
Download sequence
Identical sequences WP_003517114.1.16390 WP_003517114.1.19387 WP_003517114.1.20586 WP_003517114.1.55520 WP_003517114.1.60145 WP_003517114.1.6636 WP_003517114.1.6965 gi|385778243|ref|YP_005687408.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]