SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385778354|ref|YP_005687519.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385778354|ref|YP_005687519.1|
Domain Number 1 Region: 61-145
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 7.19e-28
Family Copper amine oxidase, domain N 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385778354|ref|YP_005687519.1|
Sequence length 259
Comment copper amine oxidase-like domain-containing protein [Clostridium thermocellum DSM 1313]
Sequence
MKKIRVFFSYLVVFCILIIFSFTGSFSFAVQNSYASADEIKVFLNGVEIKFDVAPYIKNG
RTMVPFRAIFEALGVDISWNGVNRTILATNDTTEIYIEIGKAFAYVNGYKVNLDAEAEIV
GGRTFVPLRFVSENAGADVSWDGARRTVYISYVNQVRDLGEKSYFRDLEFTVDGWESEAD
GKILKVYGKVNLENKMLMIELYDSSRKYVSGIAEITGKDGGMNLFEVNIYLNASFNPKTI
LVKTLGDSNKPIKISQYNL
Download sequence
Identical sequences A3DEW1
gi|385778354|ref|YP_005687519.1| 203119.Cthe_1258 gi|125973773|ref|YP_001037683.1| WP_003517485.1.16390 WP_003517485.1.19387 WP_003517485.1.20586 WP_003517485.1.31213 WP_003517485.1.55520 WP_003517485.1.60145 WP_003517485.1.6636 WP_003517485.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]