SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385778402|ref|YP_005687567.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|385778402|ref|YP_005687567.1|
Domain Number - Region: 489-508,538-594
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00149
Family Carboxypeptidase regulatory domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385778402|ref|YP_005687567.1|
Sequence length 599
Comment hypothetical protein Clo1313_1048 [Clostridium thermocellum DSM 1313]
Sequence
MNNLYKYTKNIALFITSSLAGIILFVWIMSINLGTSVMTSGFHKKLLEKNNIYDEVQNEI
NNLVQSIFTDLSRQLPQLGDQQEEILAILEGSISPQMVKTNLDTIADGLFKYFNGEKSFL
PDIIIDTDPTSLQSSNAAEGDSSEDTSDITNSEYVLSKIKRVNLNAILLSINRSDILDML
LFIKLIYFIMDFAPVFCALLLLLLFLKSLLLGKNIKEMLNWLFRVLMTCSILCIITAIFC
LVYSYKILPGNIYMLSVAIPLKSEVLLSYIRDCFVPLFVFFTASGILMVLLAFLVVSLNK
VANKFSSVNINIFKFKNFSIKHKKILKYTTIMLLLIFSLSLFCFELYSFKKEFESNNFSN
LISRLTNSNSYTEVISAKDDTIYMLQIKLVDAKDNSPILGIQINVNGKTDNPEKYYNIAG
ETDETGTVKFTLGKGTFHLAFSPAEGSTDYILPSPFFYELKSVGTTMLTVNLSKNQALTQ
STGITEIEVLDENNHPVEGIELYVDSEKNSPQHPEPTPSADVLHSASSKNPEPSGNPDRF
FSVTNEEGIAVFKLPSGIYNVKFSPDKLPKDYKAPELFEINCSPNLTTRYTIRLVKSPR
Download sequence
Identical sequences WP_003518873.1.19387 WP_003518873.1.20586 WP_003518873.1.55520 WP_003518873.1.6636 WP_003518873.1.6965 gi|385778402|ref|YP_005687567.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]