SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385778548|ref|YP_005687713.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385778548|ref|YP_005687713.1|
Domain Number 1 Region: 168-348
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.54e-53
Family N-acetylmuramoyl-L-alanine amidase-like 0.00011
Further Details:      
 
Domain Number 2 Region: 60-144
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 1.77e-24
Family Copper amine oxidase, domain N 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385778548|ref|YP_005687713.1|
Sequence length 352
Comment cell wall hydrolase/autolysin [Clostridium thermocellum DSM 1313]
Sequence
MKKPVILLTVLILVILMTVPGFAANGQYYSGYWGVTSNALIAVNGKVLTLERNPVIIEGR
ILVPARTTFQVLGVTTEWYSSSGVVKMVKGNKAVKMTVGSKVAHSGGSVKYMEAPPILVN
GTVMVPMRFVAETFGENVGWDAKNEMAYIGNKPAEIPSRSGLKSNRTYKVVIDAGHGGSQ
SGAVYGGVKEKDLNLDIAKRLNTLLKAEGIKTYMTREKDITVGLYTRSDLANKEKADLFV
SIHNNAGNSKTSGSMTLYHPDSGKKKGNLTAYEFAQIVQKNLNKTLGSKNMGVIQRPNLA
VLRTTNMPAVIAEIGYMSNSAELAKLKTDSYRQKAAEALRDAVIESLEKMYK
Download sequence
Identical sequences A3DE69
WP_003515588.1.19387 WP_003515588.1.20586 WP_003515588.1.31213 WP_003515588.1.55520 WP_003515588.1.60145 WP_003515588.1.6636 WP_003515588.1.6965 gi|125973531|ref|YP_001037441.1| 203119.Cthe_1016 NYSGRC-SEC-125973531 gi|385778548|ref|YP_005687713.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]