SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385778649|ref|YP_005687814.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385778649|ref|YP_005687814.1|
Domain Number 1 Region: 1947-2010
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000755
Family Type I dockerin domain 0.00072
Further Details:      
 
Domain Number 2 Region: 742-809
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000144
Family Pre-dockerin domain 0.049
Further Details:      
 
Domain Number 3 Region: 1651-1740
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000163
Family Carboxypeptidase regulatory domain 0.047
Further Details:      
 
Weak hits

Sequence:  gi|385778649|ref|YP_005687814.1|
Domain Number - Region: 86-339
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000816
Family Pectate lyase-like 0.057
Further Details:      
 
Domain Number - Region: 1408-1487
Classification Level Classification E-value
Superfamily F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 0.068
Family F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385778649|ref|YP_005687814.1|
Sequence length 2011
Comment Dockerin type 1 [Clostridium thermocellum DSM 1313]
Sequence
MEIKGDFTQIACGVTPSFYACGNHKVILSGTESQKITMEELNSCFNVLELKNTSEEGVSF
LTQVSFFGGIITNGIPIEFSRKGALGWTLSSNEEINGNFYLVGGTLDLNGYKLKINGNLI
HSGGTIVLNGGQLTVNGDYRIQTELENKDKDGKTVYDQSYGVLKMTNPKDHVLVMGDFVM
QNYYQTKDSKVLSDGVLEIKGDFTQIACGVTPSFYACENHKVILSGTKLQRITMEETYSR
FNILELKNTSEEGVVFLTPISEWKLESDQVVSGDVVVGARTIDLNGHTLRIKGDLIHPQG
TLFINGGKLIVEGDYRIQTKSVDGEGNALYKESYGVLKMTNPKDHVLVMGDFVMQNYYQT
EDSKVISEGVLEVKGDFTQIACGVTPSFYACENHKVILSGEGQQIITMEESNSRFNELIL
INPIEDGNYIFVPEGRTFWNSLEIDLDYNQSKKIHQYWVTIEKKNDTVAIGDTIDIRMRG
EENSKAEALVYYKCISKTGSADEKVITVPMKEYGPGKYQAYFKVTEDIDQIQKIQINLLD
AEGNLYTKTLGKEKEGFPLEVGATVSIDLSGVSKLEKFAGMDLVLESKGLNEQARRKITG
DTLYTITNLKPADDYRLAIESKNGFTAGTIENISISKGINDSIIVKLIEEPAKLTVIVTD
DEGNIVESGYNLTFYDPARNFKQVGTGKELEHIFVGKEISVGLTLKEELGKKFKNPVEKY
NVAIDKRESVLTLRLEKLKIITLTGIIVEDETGIPVQNANINVSQLLNNQFGNYIKLVTD
NAGRFSIEVAMGKTTLGISHEQYMNLELKAFDESTEINGDSLDLGEIQLTPYKGRLTLEL
LKKPAHTSQEEPGLEQENLYNYTISIYNKTKQAKIKNFNIKPPYIFLNDTNIETGDVIEV
TFTHKKDYTLPATIELTLDRLMNASGQAVAKENGKGMASIQSGNQRCELMVYNSDKKFIE
SCSMNREGKIISNPLKEGVYTFVFISSNNYLWRLNTLEQFEEIGLKEGIHFVKKEVEIKN
GEIKDLGLIVVPELNEKELFFTDPDVASYAVVSENNRIGKDIVLRAKYSFRKPIESQTVK
LLFRVPDQTFYVKDTLTIDGELVDSVNVSGSFIEVTTTKTEGVVRFNIRPTEAVVCYSNA
YVEFKAEGRTVREPLGVVNEVVPYLTIGAPNVTSLEKVYVTGQTLPNLEVKIYDEGSLVG
VTKANSTGAWNFQVSLGKDKSYSVHNLSARIEYNDQVIESETLEVIYKKSVPEIEKVTTI
HSNQSLILYKNGEIVPKGVYTYVPSQSYTFIVDFVGDSAEEIENLCIVSNRNGEERKLDA
KYDPQSKSWIATGSFGYNHVPGSFTVEYNLKKKRLIKEDGELNLEVLEQISTFADQFLYE
LKKENVMVGLLDENEIGFMLKEDTGGIAIVTIVIGDQPIEREKYEKMGYLFKEIDGKLGA
VLLIKDETENKIFTSKVRLASNKTEDSVKSEDDDESSQKETPLVTKDERISMAATIIGEL
GNIAGSGKVVEAIDFISGIGTAVNTIAFTPANAVTDMGYVQKKLQESENISSEDKERLRD
DLFLASGVYNFTVNANFIASLMDGHTRNGTMHKIIDIVIDKYDQYSLGDKLWEDIFGKNE
DDRESGKSTKSGKGSSIKLPLQEQKTLVDPSGYVYETVPDNRITDATVTVYYKDENGEMI
LWNAEEFGQKNPLLTDENGFYAWDVPEGMWQVKVEKEGYETAYSEILPVPPVQTNVNIPL
VSYEPPKVGHIYAYPEYIEIAFSKYVKHATLDSESIQLKQGENKVNIKIVYEDEEGNYSK
KIKLIPAEKTSFEGKYTLNISKSITSYAGVAMQKAEIRDIEIVAEPKSIEILDKVEIELR
KTVAIEIRVLPEEAAKGKKIIVTSGMEEIVSAEDVLLDERGRGKLKLKGNLPGTVDIDLR
LEGSAVEKKIQATVKFPEDNGEIIEPPVVLNGDLNRNGIVNDEDYILLKNYLLRGNKLVI
DLNVADVNKDGKVNSTDCLFLKKYILGLITI
Download sequence
Identical sequences WP_014522616.1.19387 WP_014522616.1.20586 WP_014522616.1.6636 gi|385778649|ref|YP_005687814.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]