SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385778836|ref|YP_005688001.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385778836|ref|YP_005688001.1|
Domain Number 1 Region: 106-261
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.5e-53
Family Cellulose-binding domain family III 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385778836|ref|YP_005688001.1|
Sequence length 268
Comment cellulosome anchoring protein cohesin subunit [Clostridium thermocellum DSM 1313]
Sequence
MIKSSLIKTGIITVLAMLILCGCGGRTGKEPDAAEPTISGETNKPTASVEANRDALQSID
PVYTQSPENVNGTVVPNESPENNNMDNSNQTSNTANNDGTSSSAEANIQIVLDKNTAKKD
EIITAKIILNNIPKIAGYQVNIKYDPNILQAVDLDTGKPLEDKQIPGGGDVLSNPDYNVL
PLAASDVKNGVINFAKAYVNVDEYKESNNPESSGVLALIGFKVLKEESTVISFADTPSMP
NAVSGTYVYDWDFNVLTNYSVGKGVKVN
Download sequence
Identical sequences A3DDE1
WP_003516262.1.19387 WP_003516262.1.20586 WP_003516262.1.31213 WP_003516262.1.55520 WP_003516262.1.60145 WP_003516262.1.6636 WP_003516262.1.6965 gi|125973253|ref|YP_001037163.1| 203119.Cthe_0735 gi|385778836|ref|YP_005688001.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]