SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385778868|ref|YP_005688033.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|385778868|ref|YP_005688033.1|
Domain Number - Region: 79-175
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.00843
Family Family 1 of glycosyl hydrolase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385778868|ref|YP_005688033.1|
Sequence length 215
Comment hypothetical protein Clo1313_1520 [Clostridium thermocellum DSM 1313]
Sequence
MIQIDDAGSGSFVGGTCIGVYRPETNEYFFEIIPVELYNKENFKKKLYLDAVVDIVEEAF
KALNVHKSETVEICRGYMFEKLRHWLDANGYCWYRTHISGRIQEIVEQNFMLYTMRLGVP
EAYLKYTKYPFHFHKLLRWVFADYNNRISLCKTGWQSWAKYEGIQREVHDDVMKYSHIFC
LKCGKHIRKGSRIKILRFVSNKEHFVYLHSKCHEC
Download sequence
Identical sequences A3DDB0
Cth-667 203119.Cthe_0704 gi|385778868|ref|YP_005688033.1| WP_003516196.1.16390 WP_003516196.1.19387 WP_003516196.1.20586 WP_003516196.1.31213 WP_003516196.1.55520 WP_003516196.1.60145 WP_003516196.1.6636 WP_003516196.1.6965 gi|125973222|ref|YP_001037132.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]