SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385779150|ref|YP_005688315.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385779150|ref|YP_005688315.1|
Domain Number 1 Region: 306-813
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.49e-155
Family Cellulases catalytic domain 0.00000000000000115
Further Details:      
 
Domain Number 2 Region: 1003-1146
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.92e-39
Family Cellulose-binding domain family III 0.0003
Further Details:      
 
Domain Number 3 Region: 42-198
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.33e-37
Family CBM4/9 0.0024
Further Details:      
 
Domain Number 4 Region: 210-304
Classification Level Classification E-value
Superfamily E set domains 6.3e-27
Family E-set domains of sugar-utilizing enzymes 0.00000168
Further Details:      
 
Domain Number 5 Region: 1164-1229
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.24e-19
Family Type I dockerin domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385779150|ref|YP_005688315.1|
Sequence length 1230
Comment glycoside hydrolase [Clostridium thermocellum DSM 1313]
Sequence
MKFRRSICTAVLLAVLLTLLVPTSVFALEDNSSTLPPYKNDLLYERTFDEGLCYPWHTCE
DSGGKCSFDVVDVPGQPGNKAFAVTVLDKGQNRWSVQMRHRGLTLEQGHTYRVRLKIWAD
ASCKVYIKIGQMGEPYAEYWNNKWSPYTLTAGKVLEIDETFVMDKPTDDTCEFTFHLGGE
LAATPPYTVYLDDVSLYDPEYTKPVEYILPQPDVRVNQVGYLPEGKKVATVVCNSTQPVK
WQLKNAAGVVVLEGYTEPKGLDKDSQDYVHWLDFSDFATEGIGYYFELPTVNSPTNYSHP
FDIRKDIYTQMKYDALAFFYHKRSGIPIEMPYAGGEQWTRPAGHIGIEPNKGDTNVPTWP
QDDEYAGIPQKNYTKDVTGGWYDAGDHGKYVVNGGIAVWTLMNMYERAKIRGLDNWGPYR
DGGMNIPEQNNGYPDILDEARWEIEFFKKMQVTEKEDPSIAGMVHHKIHDFRWTALGMLP
HEDPQPRYLRPVSTAATLNFAATLAQSARLWKDYDPTFAADCLEKAEIAWQAALKHPDIY
AEYTPGSGGPGGGPYNDDYVGDEFYWAACELYVTTGKDEYKNYLMNSPHYLEMPAKMGEN
GGANGEDNGLWGCFTWGTTQGLGTITLALVENGLPATDIQKARNNIAKAADRWLENIEEQ
GYRLPIKQAEDERGGYPWGSNSFILNQMIVMGYAYDFTGDSKYLDGMFDGISYLLGRNAM
DQSYVTGYGERPLQNPHDRFWTPQTSKRFPAPPPGIISGGPNSRFEDPTINAAVKKDTPP
QKCFIDHTDSWSTNEITVNWNAPFAWVTAYLDEQYTDSETDKVTIDSPVAGERFEAGKDI
NISATVKSKTPVSKVEFYNGDTLISSDTTAPYTAKITGAAVGAYNLKAVAVLSDGRRIES
PVTPVLVKVIVKPTVKLTAPKSNVVAYGNEFLKITATASDSDGKISRVDFLVDGEVIGSD
REAPYEYEWKAVEGNHEISVIAYDDDDAASTPDSVKIFVKQARDVKVQYLCENTQTSTQE
IKGKFNIVNTGNRDYSLKDIVLRYYFTKEHNSQLQFICYYTPIGSGNLIPSFGGSGDEHY
LQLEFKDVKLPAGGQTGEIQFVIRYADNSFHDQSNDYSFDPTIKAFQDYGKVTLYKNGEL
VWGTPPGGTEPEEPEEPEEPEEPAIVYGDCNDDGKVNSTDVAVMKRYLKKENVNINLDNA
DVNADGKVNSTDFSILKRYVMKNIEELPYR
Download sequence
Identical sequences Q59325
gi|385779150|ref|YP_005688315.1| WP_003519027.1.19387 WP_003519027.1.20586 WP_003519027.1.55520 WP_003519027.1.6636 WP_003519027.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]