SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385779159|ref|YP_005688324.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385779159|ref|YP_005688324.1|
Domain Number 1 Region: 372-522
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 5.23e-49
Family Cellulose-binding domain family III 0.0000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385779159|ref|YP_005688324.1|
Sequence length 522
Comment type 3a cellulose-binding domain-containing protein [Clostridium thermocellum DSM 1313]
Sequence
MNLGVVIKIKRKKAIIVTETGEFKAVNARNGMFLGQKILFDQQDVIENNRNGIGLAYSAA
IAGMVAVFVFMFTYFGLHNFNGTFAYVDVDINPSVEFAVNRDGIVVNAEPLNDDGRKVLE
ELIYKDALLEDVILDLVDKSRKYGFIEDNDRKNIILISAALNSDEQEQRNDFEKKLVDNL
MPELENLDVNIEMRFVIASKEQRKKAQENKVSMGKYMIYEMARRQGEKLTLESIMSETLE
NLLLGQDFGVIETEKTPVNTPVKSTATPTKALAAEITPTKTPEQVVMTPANTPAKPTAAP
TKAPAAVAVTSAKTPERATTVPVNTPVKPTDAPTKSPATATATATRAPVKATATPAKTLK
PSDTPVKTPDGEQSVKVRFYNNNTLSETGVIYMRINVINTGNAPLDLSDLKLRYYYTIDS
ESEQRFNCDWSSIGAHNVTGSFGKVNPSRNGADTYVEIGFTKEAGMLQPGESVELNARFS
KTDNTQYNKADDYSFNSHYYEYVDWDRITAYISGILKWGREP
Download sequence
Identical sequences A3DCG3
gi|125972925|ref|YP_001036835.1| WP_003512704.1.16390 WP_003512704.1.19387 WP_003512704.1.20586 WP_003512704.1.31213 WP_003512704.1.55520 WP_003512704.1.60145 WP_003512704.1.6636 WP_003512704.1.6965 203119.Cthe_0404 gi|385779159|ref|YP_005688324.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]