SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385779291|ref|YP_005688456.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385779291|ref|YP_005688456.1|
Domain Number 1 Region: 161-308
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.67e-49
Family Cellulose-binding domain family III 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385779291|ref|YP_005688456.1|
Sequence length 308
Comment type 3a cellulose-binding domain-containing protein [Clostridium thermocellum DSM 1313]
Sequence
MKWYYKSKVKRQVIKTLITLPVVLVLTSLVVYTFLTNNRSGSRDADGTFPDSVKSPSIAI
NTPSPGTDATASAGLVPDNTFLTEHTNAPTPTDDITPTPTPTLEPTPEPTATPTSTPTFT
PTSKPTPKPTATPTRKPTPTPTHTPTPKPAQKTPEKKGPIITVQYKNGDSTSSVTAIYPI
FKITNNGDTSVKLSDIIIRYYYTKEGNENETFWCNEFTRDGSQVYGTFVKMSKPKENADH
YLEIGFYDKAGSLKPGESVELKVGFAKNGWTKYNQFNDYSYNRVNNRFINWDHITVYLSG
KLVYGKEP
Download sequence
Identical sequences A3DC31
gi|125972793|ref|YP_001036703.1| WP_003512422.1.16390 WP_003512422.1.19387 WP_003512422.1.20586 WP_003512422.1.31213 WP_003512422.1.55520 WP_003512422.1.60145 WP_003512422.1.6636 WP_003512422.1.6965 gi|385779291|ref|YP_005688456.1| 203119.Cthe_0271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]