SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385779499|ref|YP_005688664.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385779499|ref|YP_005688664.1|
Domain Number 1 Region: 338-485
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 8.37e-37
Family Cellulose-binding domain family III 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385779499|ref|YP_005688664.1|
Sequence length 486
Comment type 3a cellulose-binding domain-containing protein [Clostridium thermocellum DSM 1313]
Sequence
MNRLGIIYEIQGMKAVVLTSEGEFLIIRRRKDMKVGQQVSFENEDIYNVRGKRFLYVAAA
VSSVAAVLVVMFLYFQSAFLSNTDNIYGYICVDINPSVELVIDETCRVLEVRPQNKDGEQ
LISGLELLDKNVEDVVYELINRSISFGFVKADDNRKIVLISGALNDKRNELKTKKENDEA
ELTELLDNIKARVDRIDNIKVRTITATSRERKDALKYGLSMGKYCLYLEAQELNGSITID
EVHDMSISDMIEKLEQMKLALKDEASPKLQTTPTLGGETAQISPESMQHSTVPGLPETPS
SSEKTIAPTLHGTPGVPDEKTLQPSTPTESSEYVQDGTKGLKIQYYSRKPHDSAGIDFSF
RMFNTGNEAIDLKDVKVRYYFKEDVSIDEMNWAVYFYSLGSEKDVQCRFYELPGKKEANK
YLEITFKSGTLSPNDVMYITGEFYKNDWTKFEQRDDYSYNPADSYSDWKRMTAYISNKLV
WGIEPN
Download sequence
Identical sequences A3DBH1 H6SHX8
gi|385779499|ref|YP_005688664.1| gi|125972583|ref|YP_001036493.1| WP_003518401.1.19387 WP_003518401.1.20586 WP_003518401.1.31213 WP_003518401.1.55520 WP_003518401.1.6636 WP_003518401.1.6965 203119.Cthe_0059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]