SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385779515|ref|YP_005688680.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385779515|ref|YP_005688680.1|
Domain Number 1 Region: 49-478
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 2.52e-146
Family Cellulases catalytic domain 0.00000000114
Further Details:      
 
Domain Number 2 Region: 499-657
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 5.76e-40
Family Cellulose-binding domain family III 0.00014
Further Details:      
 
Domain Number 3 Region: 676-741
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.09e-17
Family Type I dockerin domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385779515|ref|YP_005688680.1|
Sequence length 742
Comment glycoside hydrolase [Clostridium thermocellum DSM 1313]
Sequence
MKKMGLGRFSNKFVLTVLLFFLTAVLLPSSSFESKVQAASSPRYGGAYYNYGEALQKAIL
FYKANRLGDLPDDYILPYRADAAMTDGQDVGLDLTGGWADAGDGIKFTHPMSYAAGQLGW
AVYEYRQAFEKAGLLDDILDEIKWATDFFIKAHPEPNVLYYMCGYNDSDHSVWVPHELLD
YVTDRKSFVLNPSTPGSDVAGQTAACLAIASIIFEPTDPEYAETCLTHAKQIFEFGDKYR
GKNPLDVLYPSGGYLDDLAWGAVWLYIKTGDSTYLEKAKSFLPVTSLGGGHTHCWDDVSY
GAALKIAQLTHDEGYAAMVEKNLDFWLPGGGITYTPGGLAWLSPWGSLRYASTAAFLAFV
WADDPTVGTPSKKETYRAFAEKQINYILGDNPRKGSYVVGFGENSPKHPHHRTAHGSWVS
MLEVPSFHRHILYGALVGGPSSDDSWEDDISDYTRNEVATDYNAGFVGALAKMYDMYGGE
PLENWPQPEDFRAPEDDIVEYFCRGWIIYEGYGTLNLLLQVNNRSGWPPTMKDKLSVRYF
MDLTEVFESGGTVDDVQISLGQNEGAKLIGLKHYRDNIYYFTVDFTGTMIMPAEWEMCEK
DAHVTIKYRDGITGSNENDWSYQNLRKDPDYDATSFAGLTPYIPVYDNGVLLWGEEPPAG
GDDPGSSPPPTPTEPVIVYGDLNGDGNINSTDFTMLKRAILGNPAPGTNLAAGDLNRDGN
TNSTDLMILRRYLLKLIGSLPI
Download sequence
Identical sequences A3DBF5
203119.Cthe_0043 WP_003518381.1.16390 WP_003518381.1.19387 WP_003518381.1.20586 WP_003518381.1.31213 WP_003518381.1.55520 WP_003518381.1.6636 WP_003518381.1.6965 gi|125972567|ref|YP_001036477.1| gi|385779515|ref|YP_005688680.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]