SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385779605|ref|YP_005688770.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|385779605|ref|YP_005688770.1|
Domain Number - Region: 264-344
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 0.0366
Family Copper amine oxidase, domain N 0.022
Further Details:      
 
Domain Number - Region: 183-246
Classification Level Classification E-value
Superfamily Diphtheria toxin, C-terminal domain 0.085
Family Diphtheria toxin, C-terminal domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385779605|ref|YP_005688770.1|
Sequence length 357
Comment hypothetical protein Clo1313_2290 [Clostridium thermocellum DSM 1313]
Sequence
MSKRFSSAVIAMVVLFVLATTSFAATTETFYGGYSNVATKGSIVVELTNISSKKNVILSE
TEAEVYFDDPTETLNMVVAYDYDEDEEITVRDILEYYNNNGGVPTYYADTAPVVVTAKTA
LSTFYFCYKGDIPATYEPKFYSFEEYVYDFENKQTYTEPPEDWLLADGTSATLSEPGKYF
FIFVDDGLVSSSFPGIFCLHIGDTPSETPVPVELTKITVNPTTSKVLVNGKIVEFEAYNI
NGYNYFKLRDLAQAVNNTEKNFEVTWDAANNAINLISNKPYTPSGGELAKGDGKAKVAIP
TTSKIYKDGREIFLTAYNINGNNYFKLRDVAKTFDIGVTWDGATNTIGIDTSISYVE
Download sequence
Identical sequences WP_003517715.1.16390 WP_003517715.1.19387 WP_003517715.1.20586 WP_003517715.1.31213 WP_003517715.1.55520 WP_003517715.1.60145 WP_003517715.1.6636 WP_003517715.1.6965 gi|385779605|ref|YP_005688770.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]