SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385779685|ref|YP_005688850.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385779685|ref|YP_005688850.1|
Domain Number 1 Region: 21-228,782-815
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.29e-23
Family Type II chitinase 0.019
Further Details:      
 
Weak hits

Sequence:  gi|385779685|ref|YP_005688850.1|
Domain Number - Region: 480-535
Classification Level Classification E-value
Superfamily FomD-like 0.085
Family FomD-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385779685|ref|YP_005688850.1|
Sequence length 822
Comment hypothetical protein Clo1313_2382 [Clostridium thermocellum DSM 1313]
Sequence
MRDFLKGKRCMVWSFMGNARMYEALRDYGDRFDTVGIFTFEVDATGTITETGTSISSMLP
YIQKWPHIKWLLTIMNHGTANIFTALRNNENGAKDKFLTEIIRIMNKYPWCAGVDIDLER
GGGYENKDAANALFRDIYNTVKSYDATKLVNICLPGMTGVQGSVGGENWCVYADLNDYCD
TAAIMSYGMAWAGSAPGPVSPRDWLEGIYDYAVSVMSPDKIFMGLPAYGWNWRIHDTPEN
LGITYRGVSNTYYAAKYWMTGVYNFTGDAPPQPFIPIVAYWDDYNKVPWALPHVYDYMEG
WDAVSWEYPLQKGVYNRRRYLTSYGKEQKAEFGTIYIDRNGVPDEYEGNVIATDEMASLG
DDQASAEYRFEIREAGYYDIAVQLCFPYWDKNAIIVSLDGESKTFSENRLWWPYWRRVCW
LTLAKGVFLQEGTHAVSISGGVPGVQFYGFRVCSGFSEYPFAGEASFMLSPRRFKDVNGV
MVEPDRGFKLTFEMLRRKPDSALIWYEDFRDRNILPENYWTVLDGEWDVWQDPDSTESRP
YSQLEGYGKLAWKYDGFSDIHIRARLAFPQNSSGRAGVFLGDIFCCLNYDTQRVELYQGT
SLLGSYSTSFSKTADADLRANPNMYTIEMRKRGNMVRVYSGAASPLRFTVNVIGGSGYAG
YCSDNRTVCELLRLGDAWVYEPYERFDVELPDGNITSFGRLARTGVTWDDEFQVFSVNSD
VEESATRNEDISMDYDFFHSQLLTLSCGNDYEVKIIPKDINIWISRLFLGDADGFSILYY
QDVDSLVYWANEAAYRWKLRGIAIWSLGQEDMRLWEALPKQI
Download sequence
Identical sequences gi|385779685|ref|YP_005688850.1| WP_003520682.1.19387 WP_003520682.1.20586 WP_003520682.1.55520 WP_003520682.1.6636 WP_003520682.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]