SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385779778|ref|YP_005688943.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385779778|ref|YP_005688943.1|
Domain Number 1 Region: 2145-2236
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000000000549
Family Pre-dockerin domain 0.00035
Further Details:      
 
Domain Number 2 Region: 2244-2296
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000144
Family Type I dockerin domain 0.00073
Further Details:      
 
Domain Number 3 Region: 1694-1892
Classification Level Classification E-value
Superfamily Fucose-specific lectin 0.00000929
Family Fucose-specific lectin 0.025
Further Details:      
 
Domain Number 4 Region: 1064-1148
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0000596
Family Invasin/intimin cell-adhesion fragments 0.015
Further Details:      
 
Weak hits

Sequence:  gi|385779778|ref|YP_005688943.1|
Domain Number - Region: 1174-1242
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00518
Family Invasin/intimin cell-adhesion fragments 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385779778|ref|YP_005688943.1|
Sequence length 2300
Comment Ig domain-containing protein [Clostridium thermocellum DSM 1313]
Sequence
MKKKSFISAALIVFLFLSFCLETPNIGAVSAQNAFEDPFVHLINSHLENCETSHEEICDS
TGNEGCEVSHEEICDCTGNESCEAGHEEISDSDEHKACKAGHEACSCKCTSDSDKDNTIS
NLDMNDIEPVGNALFVEKNEENLSNIVTYASLSSVVLAASCSHQFNGSYTVTKEPTCTTT
GTKVGKCTKCGAIVSTVTIPALGHSYGSWTVTKAATCTTDGSQKRTCSRCKNVETQTIKA
TGHTFNGSYTVTKEATCTTTGTKVGKCTKCGATVSTVTIPALGHSYGSWTVTKAATCTTD
GSQKRTCSRCKNVETQTIKATGHTFNGSYTVTKEATCTTAGTKVGKCTKCGTTVSTVEIP
ALGHSYGSWTVTKAATCTTAGTEKRTCTRSGCTASETRSISATGHTFNGSYTVTKEATCT
TAGTKVGKCTKCGTTVSTVEIPALGHSYGSWTVTKAATCTTAGTEKRTCTRSGCTASETR
SISATGHTFNGSYTTIKEPTCTTTGTKVGKCTKCGEVVSSVEIKELGHDFGSWKTIKQAT
CTEKGLREGTCSRCSVRKTEEISPTGHQFNGSFTTVKEPTCTEEGLKVGKCTKCGEVVTT
APIPALGGAHQFNGSFTTVKEPTCTEKGLKEGRCTRCGATVTTTPIPELGHDFGSWKTIK
EATCTEKGLREGTCSRCSVRKTEEISPTGHQFNGSFTTVKKPTCTEEGVREGRCTKCGEV
VATAPIPALGGDHQFNGSFTTVKEPTCTEKGLKEGRCTRCGATVTTAPIPELGHDFGSWK
TIKEATCTEKGLREGTCSRCSVRKTEEISPTGHQFNGSFTTVKKPTCTEEGVREGRCTKC
GEVVATAPIPALGGDHQFNGSFTTVKEPTCTEKGLKEGRCTRCGATVTTAPIPELGHDFG
SWKTIKEATCTEKGLREGTCSRCSVRKTEEISPTGHQFNGSFTTVKEPTCTEEGLKVGKC
TKCGEEVATAPIPALGGAHQFNGSFTTVKKPTCTDPGLAEGRCSRCKTVVATKEIPPLGG
SHQFNGSYKIIKEATCTEEGLKEGRCTKCGTVISTSVIPPQHKFSKITITPDRITLGGSN
ATESPIYVKVVCSKCNTTVDVTSKAKFSSSNSNVASVVNGYVKSGTQFGTATITADYDGM
KAVCSVQVKPAGGEKLRALCITPKEDTIAEFNKWGSQVKVMAVYDDYEVDITDYVLFTSG
DRNIAYVDEYYGNKYIKSGTKKGTTLITASYEGKKDTCTVKVDMAYEVEEMPFKLGKETN
ILVPEDLPVIGGTEVEFSFDHIPGMVKYGEKDFRIAIGIEDKESLDKKWDNFVKYFEDAK
NSKASAKELRNRMKKLGSKKGSFSIKDDWEPEVEAYGYIEGVFINGIPVATRGSFAVIVE
AEYRGQKQYFIGPVPVYFEIAGGLEMELISDILRVDFETGRIMLNSELKVTPRFELGAGV
GLVKVLTVGGSGEAELEFLIITGSEDYLKVTLTGSLKLKVSSYFFSAEKEIAKGTWVLYE
SKPRLRMASPNINAQFDLYNADEYKMMPRDYIERPSEWLGNRRLMRSMATGFTNKELKVL
GTNIYPDAQPQLVNLEDKQVLVWIADNPDRTSANRTMLVYSVYDKNSGIWSEPVAVDDDG
TADFYPQLAVDGNDLYVVWQNSNKTFAEDVTLEEVVASSEIAVSKFDEVTGTFGAAVRLT
ENDVVDMLPQIIVSDGNAYIVWFTNNKNDVFGVDGENSIYYCELKDNEWSSPELLSEGLN
AIVSISAGFIEGSFAVAYALDGDDMLETIDDMEIYIVKPGDKDIRITDNDTMDSAPVFSS
FNGEGALYWYNEGNILYITQIGAEPNRVFSESKPGLKDNFKVVEGSNGETAIIWTNTAKG
SSTIFTAIYDEDRAAWSDVVKLSDVTGQVQSPDGVFDDEGNFSIAFSRLSLLEDGNEQAD
LCIIKVVPSYNLSIDSVNFDHSKVIPGTQLAIDVEVTNNGEIGVEELVVDILDGDEIINS
EAVQISLKPGESKTATVLMNLPDTIAKKAYSIRVSTVEGEEYNTDDNVKQFTIGYTDISL
QLEIYSEGDIEYVTANIINLSHVPTGATLKVTKGSEDGEVIDTKVIDSTDDIVKYEYQFD
KKILCADKETEILYFTVVADEEEIYTSDNTRTLVLSVNNDSTDKTTVSGYISVDFDYPPE
SESKIKSGFNVKVAGTELSTKTDEKGYFEISGIPGDMREFTLEISKRNYLKRNVTVNGTG
KLVVSTEDNPLILWAGDVERKGVQDNAINMVDVMEISKVFGTRAGDEEYVAELDLNMDGA
INLFDIAIVIRHFNALPSRY
Download sequence
Identical sequences gi|385779778|ref|YP_005688943.1| WP_003515825.1.19387 WP_003515825.1.20586 WP_003515825.1.55520 WP_003515825.1.6636 WP_003515825.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]