SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385777726|ref|YP_005686891.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385777726|ref|YP_005686891.1|
Domain Number 1 Region: 28-460
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.73e-144
Family Cellulases catalytic domain 0.00000000165
Further Details:      
 
Domain Number 2 Region: 478-622
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.51e-35
Family Cellulose-binding domain family III 0.00018
Further Details:      
 
Domain Number 3 Region: 636-706
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.47e-20
Family Type I dockerin domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385777726|ref|YP_005686891.1|
Sequence length 707
Comment glycoside hydrolase [Clostridium thermocellum DSM 1313]
Sequence
MKKIGILVLITALLAGIIPKSALAEEPKFNYVDAFAKSILFYEANWCGPDAGNNRIKWRG
PCHIEDGKDVGLDLTGGFHDCGDHVKFGLPQCASASTLAWAYYEFSDVFIEKGQDEYMLN
ILKHFCDYFMKCYPEKNKFYYQVGDGDVDHQYWGPPELQSYDRPTYYVATPENPGSDVAG
DTAAALALMYLNYKDRDLEYAEKCLAYAKDIYEFGMTYRGNSKGQSYYLPRDYLDELMWG
SLWLYVATGEQKYMDNLEKLMVEKRIGDEAGNSFNDNWTQCWDYVLTGVFIKLATLTDKP
LYKQIAEDHLDYWQNRIKSTPGGLKYLDSWGVCKYPAAESMVQLVYYKYTGDKRCLDFAK
SQIDYILGDNPKKMSYVVGFGDNYPKFPHHRAASGRLEGPPADETKNDPQRHILYGALVG
GADINDEYYDDIDKYVYSETGLDYNAGLVGALAGMSKYFGQGQMPEDTPGIEGEPPVYYA
DAKIYEENESGITVDLNMYNIVTSPPQYESDLSCRYFVDLSEYAGENIDMSKFVTKVYYS
PAGATISELKPYDKEKNIYYVEISFPNPVYARTYVQFCIYYYENKLWDSSNDFSYQGIGD
TYKTLENIPIYKNGVLVAGKEPSGAGPVEPTPPPKNYVYGDVNGDGKVNSTDCSIVKRYL
LKNIEDFPYEYGKEAGDVNGDGKVNSTDYSLLKRFVLRNIDKFPVEQ
Download sequence
Identical sequences WP_003514383.1.16390 WP_003514383.1.19387 WP_003514383.1.20586 WP_003514383.1.55520 WP_003514383.1.60145 WP_003514383.1.6636 WP_003514383.1.6965 gi|385777726|ref|YP_005686891.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]