SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385778774|ref|YP_005687939.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385778774|ref|YP_005687939.1|
Domain Number 1 Region: 119-487
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.1e-114
Family Amylase, catalytic domain 0.00000000728
Further Details:      
 
Domain Number 2 Region: 1-117
Classification Level Classification E-value
Superfamily E set domains 3.08e-33
Family E-set domains of sugar-utilizing enzymes 0.00054
Further Details:      
 
Weak hits

Sequence:  gi|385778774|ref|YP_005687939.1|
Domain Number - Region: 492-570
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00138
Family alpha-Amylases, C-terminal beta-sheet domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385778774|ref|YP_005687939.1|
Sequence length 575
Comment alpha amylase [Clostridium thermocellum DSM 1313]
Sequence
MKLEAIYHKPYSEFAFPVAPDTLVIRLRTAKNDVNTCILIYHEKYDTSQRGKVKMDKVAS
DGMFDYYEVELNVGIKRIKYMFYLEDNYSIKWYSSDGFFDYMPQWGHFTYSYICKDDIFH
EVEWFRNSTIYQIFPDRFAKFPPDTENSGKRTIHGGNIKGIIDRFDHLVKLGVDVVYLNP
IFKSESYHRYDVVDYYEIDPMFGSKEELRELMDLCHKNGIKVIFDGVFNHSGDKFFAFRD
VVEKGEKSKYANWYFINSFPVQGYPRPNYECFSFYGGMPKLNTGNPETAKYFLDVVKYWT
VEFGVDGWRLDAADEVDRKFWRKLRDMLKDLNKDVVLIGEIFDEASSWLWGDQFDSVINY
PLKAMINDLFAYRSIDVETFRNRISGYIMKFNKKVLSSLVNIISTHDTPRFLTLCNGDEK
RFELAVVFQFTFPGVPLIYYGDEIGMEGEGDPDCRRPMIWDEAKWNKKTLELYKFLIGLR
KRFDALRTGEYGELPVTGCNGILAYRRGRGENGIIVAMNTLDRKENVVVETGDSFDTVKA
FESLKDEKRLNVDKKRINICLNPFEWRIYKACGEL
Download sequence
Identical sequences gi|385778774|ref|YP_005687939.1| WP_003516388.1.19387 WP_003516388.1.20586 WP_003516388.1.55520 WP_003516388.1.6636 WP_003516388.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]