SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385779287|ref|YP_005688452.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385779287|ref|YP_005688452.1|
Domain Number 1 Region: 286-811
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 6.24e-112
Family Glycosyltransferase family 36 C-terminal domain 0.0000000414
Further Details:      
 
Domain Number 2 Region: 1-265
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.22e-86
Family Glycosyltransferase family 36 N-terminal domain 0.00000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385779287|ref|YP_005688452.1|
Sequence length 811
Comment glycosyltransferase [Clostridium thermocellum DSM 1313]
Sequence
MKFGFFDDANKEYVITVPRTPYPWINYLGTENFFSLISNTAGGYCFYRDARLRRITRYRY
NNVPIDMGGRYFYIYDNGDFWSPGWSPVKRELESYECRHGLGYTKIAGKRNGIKAEVTFF
VPLNYNGEVQKLILKNEGQDKKKITLFSFIEFCLWNAYDDMTNFQRNFSTGEVEIEGSVI
YHKTEYRERRNHYAFYSVNAKISGFDSDRDSFIGLYNGFDAPQAVVNGKSNNSVADGWAP
IASHSIEIELNPGEQKEYVFIIGYVENKDEEKWESKGVINKKKAYEMIEQFNTVEKVDKA
FEELKSYWNALLSKYFLESHDEKLNRMVNIWNQYQCMVTFNMSRSASYFESGIGRGMGFR
DSNQDLLGFVHQIPERARERLLDLAATQLEDGGAYHQYQPLTKKGNNEIGSNFNDDPLWL
ILATAAYIKETGDYSILKEQVPFNNDPSKADTMFEHLTRSFYHVVNNLGPHGLPLIGRAD
WNDCLNLNCFSTVPDESFQTTTSKDGKVAESVMIAGMFVFIGKDYVKLCEYMGLEEEARK
AQQHIDAMKEAILKYGYDGEWFLRAYDDFGRKVGSKENEEGKIFIESQGFCVMAEIGLED
GKALKALDSVKKYLDTPYGLVLQNPAFTRYYIEYGEISTYPPGYKENAGIFCHNNAWIIC
AETVVGRGDMAFDYYRKIAPAYIEDVSDIHKLEPYVYAQMVAGKDAKRHGEAKNSWLTGT
AAWNFVAISQWILGVKPDYDGLKIDPCIPKAWDGYKVTRYFRGSTYEITVKNPNHVSKGV
AKITVDGNEISGNILPVFNDGKTHKVEVIMG
Download sequence
Identical sequences A3DC35
WP_003518177.1.19387 WP_003518177.1.20586 WP_003518177.1.31213 WP_003518177.1.55520 WP_003518177.1.6636 WP_003518177.1.6965 gi|125972797|ref|YP_001036707.1| gi|385779287|ref|YP_005688452.1| 203119.Cthe_0275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]