SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385779506|ref|YP_005688671.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385779506|ref|YP_005688671.1|
Domain Number 1 Region: 149-334
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.00000000000441
Family Type II chitinase 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385779506|ref|YP_005688671.1|
Sequence length 419
Comment hypothetical protein Clo1313_2180 [Clostridium thermocellum DSM 1313]
Sequence
MSAKNAQTILSNKCFSVILVVLVLVFSLAACKDTGVQVNNPAPTAQATDNGEANNGGNTD
GEAPETSEPSEESPVPNNSGEDAKPVKKDIKVKALYLTGWTVGSDERLQHYVDLANRTEI
NAYVVDIKDDDGYVGYESNIPAVREIGAWKSKYNVDKVLKTFHDNNIHVIGRLVCFKDPV
LSSKKPELAVKSVNGGSWRDNHNLTWLDPYNKDSWPYLIEIAKEAVEKGFDEIQFDYIRF
PNDGSKKSMSFNTGGKEKHEIINEFLAYAREQLPGVVLSADVFGIILESPADTEDIGQYL
EKIVKDVDYISPMVYPSHYAVGQIVNGVQFMKPDLDPYGVVYQSLVKCNNRLAQVEGYKA
DVRPYIQDFTASWLGKGYYQSYGPEQLRQQIQAVYDAGYEEWICWDANNTYSEEAFLKE
Download sequence
Identical sequences WP_003511984.1.16390 WP_003511984.1.19387 WP_003511984.1.20586 WP_003511984.1.55520 WP_003511984.1.60145 WP_003511984.1.6636 gi|385779506|ref|YP_005688671.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]