SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385779760|ref|YP_005688925.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385779760|ref|YP_005688925.1|
Domain Number 1 Region: 231-640
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 2.11e-102
Family Bacterial glucoamylase C-terminal domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385779760|ref|YP_005688925.1|
Sequence length 644
Comment glycoside hydrolase 15-like protein [Clostridium thermocellum DSM 1313]
Sequence
MANTYFNDAIIGNSGMLVCLTRNGELTRLFWPNIDYPQHFEKMATGIFYTGQKNSTSWFY
EDNWHHTQYYVEDTNILKTICEDGGRGLRVEQTDFVLKDRDVMVRRYVIENIGPNEVDLG
FVQYSSTVSTTPELRSTLFDFNVDALIHYRHNYYISISSDSEVVQFQLGNNAFDCARYTE
LYGYDSIGMMKDGAMSFNIGKIEPGGKKTFNLFICASHTLKGVKELVRWCRKMNVDEEYE
KTRKYWLDFLKNARLIVTGDKNIDNLYKRSILVFKLMSDERTGGLLASAEIDEGFTRCGR
YAYCWGRDAAFITGALDTAGLTEAVDKFYQWAVMTQDDDGSWQQRYHMDGNLAPSWGLQI
DETGTLIWGMLKHYEVTKNIDFLKSMWESIKKGVEFLTRFIDSDTGLPAPSYDLWEERVG
EHTYSSAAVYAGIKAGAEAARILGASEELIEKWEKAASDMKASIEKNFWRDEAGRFIRSV
RTKLNPWGSEHSPYTTVIKVNEKGYFRDVTLEDWTIDVSLLGVSIPFGVFDVHDERVKKT
VEAIERALTSHPVGGIKRYENDNYIGGNPWVLATLWVALYYIEIKEYEKAKDYLRWATKS
CTALGLLPEQVSKDNGEPCWVIPLTWSHAMYVLVLAGLKEAGVL
Download sequence
Identical sequences A3DGC9
gi|385779760|ref|YP_005688925.1| gi|125974291|ref|YP_001038201.1| 203119.Cthe_1787 WP_003515869.1.16390 WP_003515869.1.19387 WP_003515869.1.20586 WP_003515869.1.31213 WP_003515869.1.55520 WP_003515869.1.60145 WP_003515869.1.6636 WP_003515869.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]