SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385779772|ref|YP_005688937.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385779772|ref|YP_005688937.1|
Domain Number 1 Region: 212-401,457-494
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.36e-40
Family Type II chitinase 0.017
Further Details:      
 
Domain Number 2 Region: 52-96
Classification Level Classification E-value
Superfamily LysM domain 0.000000000000536
Family LysM domain 0.0035
Further Details:      
 
Domain Number 3 Region: 2-45
Classification Level Classification E-value
Superfamily LysM domain 0.00000000000085
Family LysM domain 0.0052
Further Details:      
 
Weak hits

Sequence:  gi|385779772|ref|YP_005688937.1|
Domain Number - Region: 126-158
Classification Level Classification E-value
Superfamily SH3-domain 0.0168
Family SH3-domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385779772|ref|YP_005688937.1|
Sequence length 503
Comment Peptidoglycan-binding lysin domain [Clostridium thermocellum DSM 1313]
Sequence
MWYTVQPGDSLYTISQRFGVTIAQIKSANQLTSDIIYVGQRLYIPIGIQAPVVYTVRPGD
TLYLIARRYNTTVDSLMALNNLSSTELRIGQQLTIPLYTEAVVNVGTANIRRGPGTNFGI
ITRMTNGARLPVIGFSNNWYQVRLYNGREGWISGSIVTRNVYSGRRPITGVLGFYTLEEG
PTLPSSFTSFANNTGQLSSTALFMFRISAANPTTIEKFGEFTDQDVRNLVAIAHRNNVKI
MPVVHNLLYRPGGTTLAKNVVKTLVSDPRNRNAFALNLVNLIERYGFDGVNIDIEDVFIE
DSDNLSLLYTEISEVLRPRGYFFSASVPSRVSDEPFNPFSDPFNYSVIGRAVDEFVVMLY
NEFGWPGSPPGPAVTIGWMERVLRYTMSKMPRDKIMAAVSVFGFDFNLTTGRNTYVTYQS
AINLARRYNSEIIFNEERQTPMFTYRDAQGNQHEVWFEDARSLRSKIQLAWELGIKGVAL
WRLGMEDPNIWPMLRNEVVVRKF
Download sequence
Identical sequences A3DGE2
CmR101 NYSGXRC-11096a 203119.Cthe_1800 WP_003515837.1.16390 WP_003515837.1.19387 WP_003515837.1.20586 WP_003515837.1.31213 WP_003515837.1.55520 WP_003515837.1.6636 WP_003515837.1.6965 gi|125974304|ref|YP_001038214.1| gi|385779772|ref|YP_005688937.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]