SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385780061|ref|YP_005689226.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385780061|ref|YP_005689226.1|
Domain Number 1 Region: 102-323
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.02e-26
Family beta-glycanases 0.014
Further Details:      
 
Domain Number 2 Region: 739-808
Classification Level Classification E-value
Superfamily Type I dockerin domain 2.26e-18
Family Type I dockerin domain 0.00078
Further Details:      
 
Domain Number 3 Region: 442-577
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.54e-18
Family Family 6 carbohydrate binding module, CBM6 0.033
Further Details:      
 
Domain Number 4 Region: 585-723
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.94e-17
Family Family 6 carbohydrate binding module, CBM6 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385780061|ref|YP_005689226.1|
Sequence length 810
Comment carbohydrate binding family protein [Clostridium thermocellum DSM 1313]
Sequence
MKVKNTKKAVKKWCAIFLTVMLVMSVMPLPKSFAANQVLTVDLAADTGEICYGAIGGLYA
MGSPGVPTDNVIVPLGMKAISQKAPDGLQHPTGDALKVAPQFIEAGGEYVMIMMQDIYRN
WPYEDLGINDYLAKIETICRKVVADPYRHKYVYVPINEPEWIWYRGNMTKLCNEWKMMYD
KIRSIDPTAKIAGPNYAVYNSSAYRQFMTFCKNNNCLPDIVTWHELDDGFFSNWYNHYND
YRNIEKSLGISPRPININEYGRINVDGGIPGNLVQWIARFENSKVYACLAYWTTAGTLND
LVTQNNKATGAWWLYKWYGELTGHTVQVTPPSLNGSLQGLAALDRNKKQARVIFGGSLRS
TDVFNTDVVVKGFNSHSYFGNSVHVIVWGVDNTGTNPSSGPYLVHEGDYNISNGQITVTV
NNMKALSAYHMIITPNTDLSPANNRNRYEAEYARILGTATVSHGGHSGYSGTGFVEGYAG
SNNASTNFVVTAETDGYYNVTLRYSAGPYPGAPKTRYLRMVVNGGLHKDVACIQTANWDT
WESTTVKVFLQAGINRLDFKAFASDESDCVNIDYIDVEPTSGTINVYEAEDPANTLGGAA
VRQRDNAASGGQYVGWIGNGSNNYLQFNNVYVPQAGTYRMVVQFANAEVFGQHSYNNNVV
DRYCSISVNGGPEKGHYFFNTRGWNTYRTDIIDVYLNAGNNTIRFYNGTSGSYAPNIDKI
AIAAPFEGGTEPTPPEEDFVYGDVDGNGTVNSTDVNYMKRYLLRQIEEFPYEKALMAGDV
DGNGNINSTDLSYLKKYILKLISAFPAETN
Download sequence
Identical sequences gi|385780061|ref|YP_005689226.1| WP_003516694.1.19387 WP_003516694.1.20586 WP_003516694.1.55520 WP_003516694.1.6636 WP_003516694.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]