SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385780062|ref|YP_005689227.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385780062|ref|YP_005689227.1|
Domain Number 1 Region: 178-487
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.69e-73
Family alpha-L-arabinanase-like 0.0014
Further Details:      
 
Domain Number 2 Region: 24-161
Classification Level Classification E-value
Superfamily AbfB domain 1.31e-40
Family AbfB domain 0.00015
Further Details:      
 
Domain Number 3 Region: 509-576
Classification Level Classification E-value
Superfamily Type I dockerin domain 4.97e-18
Family Type I dockerin domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385780062|ref|YP_005689227.1|
Sequence length 580
Comment glycoside hydrolase [Clostridium thermocellum DSM 1313]
Sequence
MILLATSVCYSSNPSITQASTGADGAIAKLQSYNYSHMYIRNANFDVRIDDNVTPETDAQ
WVLVPGLANSGEGYVSIQSVDHLGYYLRHWNYDFRLEKNDGTRIFAEDATFKMVPGLADP
SYTSFQSYNYPTRYIRHYNYLLRLDEIVTALDREDATFRVIDSSSVDPDKADDSVIVTNP
IVRRRADPWVYRHTDGYYYMTASVPEYDRIELRRSRTLQGLSTATPKTIWRRHSSGIMGG
HIWAPEIHFIDGKWYIYFSAGTSTNYFDIRLYVLECSDSNPLTGTWVEKGQLKTNWESFT
LDATTFEHNGTRYLVWAQKDPKIASNSNIYIAKMNGPLAITGNQVMISTPEYSWEKIGYA
VNEGPAVLKKNGKIFITFSASATDANYCMGLLTASDTANLLDPKSWHKSPNPVFQSNPST
GQYGPGHNSFTTSPDGKVDIMVYHARNYRDITGDPLYDPNRHTRAQIVNWNADGTPDFGI
PVADGTNVIYIPPQTPTPIPTNSPTPSDLIYGDINGDNSVNSTDLTILKRYLLGSTVPTA
PNWRLAADLNLDGNINSTDFTILKRYILGRIEAPPWVNQT
Download sequence
Identical sequences A3DHB3
gi|385780062|ref|YP_005689227.1| gi|125974625|ref|YP_001038535.1| WP_003520229.1.19387 WP_003520229.1.20586 WP_003520229.1.31213 WP_003520229.1.55520 WP_003520229.1.6636 WP_003520229.1.6965 203119.Cthe_2138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]