SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|66766476|ref|YP_241238.1| from Xanthomonas campestris pv. campestris str. 8004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|66766476|ref|YP_241238.1|
Domain Number 1 Region: 12-222
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.6e-16
Family Pentraxin (pentaxin) 0.044
Further Details:      
 
Weak hits

Sequence:  gi|66766476|ref|YP_241238.1|
Domain Number - Region: 828-908
Classification Level Classification E-value
Superfamily Putative isomerase YbhE 0.0288
Family Putative isomerase YbhE 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|66766476|ref|YP_241238.1|
Sequence length 1295
Comment hypothetical protein XC_0127 [Xanthomonas campestris pv. campestris str. 8004]
Sequence
MSVSKVLLGMLCMIALPLSAATPTAPELLFRVSADRSLEADVARGDGVPNFRDKIALVPT
GKRGNAIEWADDGVLSWNAPGNLYTQRGTLSFFWRARYAVGEAPFVIFRVGYADHTSWDM
AWLRIDWNGHGFDAFVTDANLARTRVSFKLDKHPTASDWTHIAFAWDETRGVRLYVDGKE
AARVDCGAPCANGGALDFDAALDQFGLAGRVMSPHQVQSRYNFLRGSDFDEIRIYDRMLD
GAGAAALARLQEPTSAEAPTNDAQHAAFLHRYGWDNGHTPPALTAPVTRIRKVEFTDARD
LKQWMWKATDGIAETTWPGVYNRSRLPGRNDYFQLPDWNTYVEGGKALDLTLPDEPVNRI
ELRGAAYGQASYTAPTATGATNAQAQPLFDRKQGVVRSVDTFAERRGGTLRFANTAQETP
IQEIWAYNVQPGEVPAVSAQLSYTVRSDIQPDYDNLATLRDVIAGRYPPGERQTVVALPT
KAPARKRPSDKTAASRAQHPIVHILVPSSLGDPPPDQPLMRSWSYGWENMHDGLDGIAIT
LPALNLPATHNGSIPLNIRIKDPIWPARDMIDVSVAVAPGQARTLWLDLRDRILSNDSLM
LSIAAAAPGFDANALDGTQLQLVFKPRAEAIKEHVADRFNQVKDNWGFLVEEHTTSKRQL
LYKRLDADITDLLRVDPDHALGRQYWNDISYANQGALPVEMPSVPKGVPAWAFWQLQDLS
ATRRYIRWWIEQRQVAYGDFGGGISDDSDLVQQWPGVALMGVDPDMLNASMLALSDANYR
NGMFTNGLSTIETDELHAYEEGINLNSALLYLNWGDPRTVERLMETVKAFDNVIQVNPQG
HLLFASNWFGGRKVYREPNWQWQKPYSFPVVHPAIILGAYNADPNSRRIVTGLADGYLAH
AYTNGKGNWALPNEINWQTGKTRGGELFEGSGGADTLHTFWAAYRFTGDARYLKPINYRV
ANSGPNGLSLLNENFLDVMGKRSDWSGKLIDAANKDDGSAPDFPHHVAWEQTGNLDYLAT
LYRSEAREKLQNFYMNTEGHWWSDRVESPTVNLQRARLGGVALKRNQTYPGHTVSWRFND
PEAATQVAIAIPAPQQDRFTVIAYNTSNKAQRASMTGWNVAPGQWRITQGVSKANDDKLD
GAGKTREVAFEKSASLDIDFPAGRTTVLQLERIAATTPVELRPDLGIGHGDVRVTADAIE
VTVHSLGHADAPAGFVVLEDARGKELARAAFPALAAPRDLQPITTQVRLPLTNAASAKAA
QLRVITDGNVAEITDLNNNLALPAQAKPAIAENSQ
Download sequence
Identical sequences A0A0H2X3X7 Q8PE58
190485.XCC0123 314565.XC_0127 gi|66766476|ref|YP_241238.1| NP_635518.1.47755 WP_011035381.1.1732 WP_011035381.1.18295 WP_011035381.1.27778 gi|21229601|ref|NP_635518.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]