SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|66767119|ref|YP_241881.1| from Xanthomonas campestris pv. campestris str. 8004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|66767119|ref|YP_241881.1|
Domain Number 1 Region: 42-265
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.65e-52
Family Xylanase/endoglucanase 11/12 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|66767119|ref|YP_241881.1|
Sequence length 271
Comment cellulase S [Xanthomonas campestris pv. campestris str. 8004]
Sequence
MQQTQHRILDQATAQAPTTRRRASRWWKAALTLGLVALAPVALAGPYKIFGNHYAWVNNF
NDPNNIIQGTFGTGSTPELTVTFNFADYNLYGYPAIVRGWHYDWNPTSDTLFPKQISSIS
SIPMKFSYSAGGTNLAGDFAYDIFFRWDTAKGNPQLEVMIWGDHNSWPIGTLTASKVITA
GGRTFDLWEGFNSGAGYYVYTFIPTGTAGQATLKTSGSLNVDAKPFLNWLQTNRSKDGRY
NNSMYLHAAEAGFEVVRGNGWAKVSATMDAK
Download sequence
Identical sequences A0A0H2X490 B0RNX4 G0CFQ7 Q8P5G0
gi|21232810|ref|NP_638727.1| gi|66767119|ref|YP_241881.1| gi|188990213|ref|YP_001902223.1| NP_638727.1.47755 WP_011038479.1.10627 WP_011038479.1.12135 WP_011038479.1.12496 WP_011038479.1.15229 WP_011038479.1.16446 WP_011038479.1.18295 WP_011038479.1.22538 WP_011038479.1.25266 WP_011038479.1.27778 WP_011038479.1.31612 WP_011038479.1.36111 WP_011038479.1.36449 WP_011038479.1.40219 WP_011038479.1.43481 WP_011038479.1.4502 WP_011038479.1.475 WP_011038479.1.56666 WP_011038479.1.80866 WP_011038479.1.82601 WP_011038479.1.88278 WP_011038479.1.89271 gi|384429335|ref|YP_005638695.1| 190485.XCC3381 314565.XC_0783 509169.xccb100_0818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]