SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|66767120|ref|YP_241882.1| from Xanthomonas campestris pv. campestris str. 8004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|66767120|ref|YP_241882.1|
Domain Number 1 Region: 33-255
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.59e-45
Family Xylanase/endoglucanase 11/12 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|66767120|ref|YP_241882.1|
Sequence length 262
Comment cellulase S [Xanthomonas campestris pv. campestris str. 8004]
Sequence
MQTSTHAVRFAPSWLAGSVVAALLLTAGTAIAYTGQTKVYGTQYAYNNNFNDSNNAITAT
FGSGSTPSMTVSYSLPSGQLYGYPAICRGWHYTMNPATDSFFPHQVSAIKTLSGAVAFTT
KGSGQTGDFAYDLFFRKDASKGTPQLEVMIWGANNSYPLGTLSVPNAISSGGVSYDLWQG
NNDAAGYYVYTFIPHGTAGNSNPLPTSGHLNANIKAFLDRLQTLRSGDGRYSNALYLQVV
EGGFEVTGGTGSVSLSGGITAN
Download sequence
Identical sequences A0A0H2X5X8 B0RNX5 Q8P5G1
190485.XCC3380 314565.XC_0784 509169.xccb100_0819 gi|188990214|ref|YP_001902224.1| NP_638726.1.47755 WP_011038478.1.10627 WP_011038478.1.12496 WP_011038478.1.15229 WP_011038478.1.16446 WP_011038478.1.1732 WP_011038478.1.18295 WP_011038478.1.22538 WP_011038478.1.27778 WP_011038478.1.31612 WP_011038478.1.36449 WP_011038478.1.40219 WP_011038478.1.43481 WP_011038478.1.4502 WP_011038478.1.475 WP_011038478.1.56666 WP_011038478.1.82601 WP_011038478.1.88278 WP_011038478.1.89271 gi|66767120|ref|YP_241882.1| gi|21232809|ref|NP_638726.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]