SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|66769360|ref|YP_244122.1| from Xanthomonas campestris pv. campestris str. 8004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|66769360|ref|YP_244122.1|
Domain Number 1 Region: 23-279
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.58e-67
Family Glycosyl hydrolases family 16 0.0037
Further Details:      
 
Weak hits

Sequence:  gi|66769360|ref|YP_244122.1|
Domain Number - Region: 331-447
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000102
Family CBM11 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|66769360|ref|YP_244122.1|
Sequence length 452
Comment endo-1,3-beta-glucanase [Xanthomonas campestris pv. campestris str. 8004]
Sequence
MNMRCNVAVQVAVLLGTACAALTPQLRAQTLVWEDNFNGPAIDGNTWTYDVGNGCQIGLC
GWGNGEMQYYTSRPENARIENGRLVIEARREAFQGMPFTSARLKTEGRMHFKYGTLEARI
KTPVVGNGLWPAYWMLGTIGVWPGRGEIDLMEAGMAAAIANGTANRRIGAAVHWDYNGAQ
ADYDTSYTHPVDLHNDFHVYRMTWDPNVIRMSIDGQQYFEFAISNIEGASLHEFHQQHYL
LLNLAVGGTFTGINTPGGVTAPLPGKMEVDYLRLYQNPGASLYVGAQHTAPAGRFGVFTD
QTDTAARLTFGQDAQLYLWNNLSPIAQAPFEGGNVMAYRANAGAWYGLGIQTDYRDMRNY
AGGSLKLHLKTTTPSTFKIGINTSFGDSWVDFVPGGNQYGLVRDGVWHEVSIPFSAFYDL
DLQSVKQMFMLVADPPASPVEIAIDKVYYQSR
Download sequence
Identical sequences A0A0H2X9K6 Q8PBD4
gi|21230645|ref|NP_636562.1| gi|66769360|ref|YP_244122.1| NP_636562.1.47755 WP_011036385.1.12135 WP_011036385.1.12496 WP_011036385.1.15229 WP_011036385.1.16446 WP_011036385.1.18295 WP_011036385.1.27778 WP_011036385.1.31612 WP_011036385.1.36449 WP_011036385.1.40219 WP_011036385.1.40437 WP_011036385.1.475 WP_011036385.1.56666 WP_011036385.1.89271 190485.XCC1188 314565.XC_3054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]