SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77761271|ref|YP_244132.2| from Xanthomonas campestris pv. campestris str. 8004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77761271|ref|YP_244132.2|
Domain Number 1 Region: 39-345
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 3e-87
Family alpha-L-arabinanase-like 0.000000922
Further Details:      
 
Domain Number 2 Region: 362-548
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-34
Family Beta-D-xylosidase C-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|77761271|ref|YP_244132.2|
Sequence length 549
Comment xylosidase/arabinosidase [Xanthomonas campestris pv. campestris str. 8004]
Sequence
MCGIALAMACQMAMAGTALITQVDYQGDDGGAVPTDAQYRNPVLAGFYPDPSAIRVGNAF
YLVTSSFGYFPGLPVFKSSDLVHWIQIGNAIDRPGQINYGNDALTRGLFAASISHHDGTF
YIANTCFYCDGGNFLITAKDPAGPWSDPIWLDAKGIDPSLFFDDDGSAWLVNNDVPAGTL
RYDGHRAIWLQQLDLARMKLVGPRQVIVDSGFQPASNPEHIEGPHLFRRDGYYYLTAAEG
GTGEQHAQMVYRSRQIAGPYEPWSGNPVLTQRDLDPARPAPITSAGHAQFVELADGSWWA
VFLATRPYRGNHYTLGRETFLLPVQWRDGWPLVLPHGKAIPSVATRPPLPAGTQATPTSG
PMHWSERFDGARVPMQWMTIHPPRQPWFATGPTGLRITPSTIALGTEGAGQPAYLGHRLQ
HHHATLVASVDGSDLSIGEQAGLAVVAKESHFLAAMLVREAAGNAVVLYRRAGTQEPPTG
VVQARMPLPAVTQPVTLRVALDAATVHVDFAVGDGQWQTLLERGDASLLSTETAGGFLGA
TFGPYAYRP
Download sequence
Identical sequences gi|77747791|ref|NP_636552.2| 190485.XCC1178 314565.XC_3064 gi|77761271|ref|YP_244132.2| NP_636552.2.47755 WP_011036375.1.18295 WP_011036375.1.27778 WP_011036375.1.43481 WP_011036375.1.475 WP_011036375.1.88278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]