SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|66770451|ref|YP_245213.1| from Xanthomonas campestris pv. campestris str. 8004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|66770451|ref|YP_245213.1|
Domain Number 1 Region: 60-338
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.3e-70
Family alpha-L-arabinanase-like 0.0000275
Further Details:      
 
Domain Number 2 Region: 359-541
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-21
Family Beta-D-xylosidase C-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|66770451|ref|YP_245213.1|
Sequence length 544
Comment xylosidase [Xanthomonas campestris pv. campestris str. 8004]
Sequence
MPTPTRRDVFKLLAASAGAAVAPAALGATAAPPAAACGQLLQWGRGVEGQRTADLGNGTY
RNPIVAGDRPDPTILKDGDDYSMTFSSFFSYPGIVLWHSTDLVNWTPIGPALRQQLGTIW
ALDLCKHDGRYFIYIPANPDDRGWSIFVIWADDIRGPWSAPIDLKIAGCIDPGHVVGEDS
ARYLFVNGIRKIRLRADGLATDGPLEPAYAPWRYPDDWVVENFAPEGPKLNWHNGWLYLV
TAVGGTAGPVTGHMVIAARSRSVHGPWEHCPHNPLVRTQSPQEPWWSRGHATLVEGPRGD
WWMVYHGYENGFRTLGRQTLLEPIEWTADGWFRATGGDLSRPLRTPARTATGSANMATGF
ALSDDFSTDKLGTQWSLHAPKPGEQARIQRGDRVLTLACTGTSPADSAPLTCGVPDRAYA
AEVTLELVGNAEGGILLFYNHKAFVGIGFTADTMKTYEYSEELVWARAPNTQRHIRLRLT
NDQQVVTYHYSFDEGRNWLRHPTRMEVSGMHHNVFGGFLSLQLGIYAAQEGSVVLRDFRY
RALG
Download sequence
Identical sequences A0A0H2XCJ9 Q8P3K7
gi|21233486|ref|NP_639403.1| NP_639403.1.47755 WP_011039133.1.12496 WP_011039133.1.16446 WP_011039133.1.1732 WP_011039133.1.27778 WP_011039133.1.40219 WP_011039133.1.475 WP_011039133.1.56666 gi|66770451|ref|YP_245213.1| 190485.XCC4064 314565.XC_4154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]