SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000000364 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000000364
Domain Number 1 Region: 140-232
Classification Level Classification E-value
Superfamily Fibronectin type III 2.28e-23
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 2 Region: 257-346
Classification Level Classification E-value
Superfamily Immunoglobulin 2.55e-20
Family I set domains 0.0051
Further Details:      
 
Domain Number 3 Region: 58-148
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000732
Family I set domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000000364   Gene: ENSSARG00000000404   Transcript: ENSSART00000000401
Sequence length 349
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_2136:678:15998:-1 gene:ENSSARG00000000404 transcript:ENSSART00000000401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAAAPKVTSGVAPKLQEAGTADTAGPQAGQDASSPLPQPAPLVEEPPKIWLPRFLKQT
YIRKVGDTVNLLIPFQGRPKPRATWTHNGHALDTSRVSVRDGERDSVLFVREAQRTDSGH
YQLSLQLGGLEDTATIDILVVERPGPPQSIKLVDVWGSNATLEWTPPQDTGNTVLLGYTV
QKADRKSGLWFTVLEGYHRTSCVISNLIVGNSYTFRVFAENLCGLSETAAVTADVAHVQK
AAAVYKTEGFALREFWEAPRFTQPLADCTPVPGYNTQLFCCVRASPKPKIIWLKNKMEIQ
DNPKYRALTQLGICSLEIRKPGPFDGGIYTCKAINALGEASVECRVDMQ
Download sequence
Identical sequences ENSSARP00000000364 ENSSARP00000000364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]