SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000001457 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000001457
Domain Number 1 Region: 32-130
Classification Level Classification E-value
Superfamily Immunoglobulin 2.4e-35
Family V set domains (antibody variable domain-like) 0.0000587
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000001457   Gene: ENSSARG00000001614   Transcript: ENSSART00000001602
Sequence length 133
Comment pep:novel scaffold:COMMON_SHREW1:scaffold_205034:5810:6291:-1 gene:ENSSARG00000001614 transcript:ENSSART00000001602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRCLRMDLVRRNVHQHWLLLFLVAAPGCVLSQVLLQELGPSLVAPSQTLSLTFSVSGFSL
TRNRVHWVRRAPGKGLEWIGIIWSDGSTAYNPSLQSRLSISRDTSKSQVYLKLSNSVTED
TAMYYCAKYTVRT
Download sequence
Identical sequences ENSSARP00000001457 ENSSARP00000001457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]