SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000005148 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000005148
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 4.03e-30
Family MHC antigen-recognition domain 0.0000322
Further Details:      
 
Domain Number 2 Region: 85-179
Classification Level Classification E-value
Superfamily Immunoglobulin 7.58e-23
Family C1 set domains (antibody constant domain-like) 0.0000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000005148   Gene: ENSSARG00000005708   Transcript: ENSSART00000005680
Sequence length 227
Comment pep:novel scaffold:COMMON_SHREW1:scaffold_186040:7530:8853:-1 gene:ENSSARG00000005708 transcript:ENSSART00000005680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DHVGAYGALFYQSYGPSGQFTFEFDGDEEFYVDLDKKETIWWKPEFSQFGGFDPQGGLTN
IATAKHNINILMKRFNGTTAINEVPEVTVLPKFHALPGEANILICLVDNIFPPVINITWL
HNGQSVKEGVSETSFLTKDDHSFLKISYLTFIPSEDDIYDCKVEHWGLDKPLLKHWELEI
PAPMSEVTENVICALGLSVGLVGIMAGTIFIIQGLRSGSASRPQGPL
Download sequence
Identical sequences ENSSARP00000005148 ENSSARP00000005148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]