SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000006037 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000006037
Domain Number 1 Region: 1624-1985
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.57e-92
Family Hect, E3 ligase catalytic domain 0.0000205
Further Details:      
 
Domain Number 2 Region: 439-736,826-938
Classification Level Classification E-value
Superfamily ARM repeat 1.38e-36
Family Armadillo repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 737-800
Classification Level Classification E-value
Superfamily WWE domain 0.000000157
Family WWE domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000006037   Gene: ENSSARG00000006623   Transcript: ENSSART00000006652
Sequence length 1992
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_4380:7662:126074:-1 gene:ENSSARG00000006623 transcript:ENSSART00000006652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNRPNNNPGGSLRRSQRNTAGAQPQDDSIGGRSCSSSSAVIVPHPEDPDRANTSERQKT
GQVPKKDNSRGVKRSASPDYNRTNSPSSAKKPKALQHTESPSETSKPHTKSKKRHLEQEQ
QLKSAQLPSTSKAYTRKSGATGSSRSQKRKRTESSCIKSGSVSESTGAEEKSAKPTKLAS
KSAASAKAGCSTITDSSSAASTSSSSSTVASASSTVPPGARVKQGKDQNKARRSRSASSP
SPRRSSREKEQSKTGGSSKFDWAARFSPKVSLPKTKLSLPGSSKSETSKPGPSGLQAKLA
SLRKSTKKRSESPPAELPSLRRSTRQKTTGSCASASRRGSGLGKRGTADARRQEKMADPE
SNQETVNPSAARTDETPQGAAGAVGMTTSGESESDDSEMGRLQALLEARGLPPHLFGPLG
PRMSQLFHRTIGSGASSKAQQLLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKS
VVPALITLLQMEHNFDIMNHACRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAE
QALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFV
ADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNVQQLLVVTP
PILSSGMFIMVVRMFSLMCSNCPTLAVQLMKQXXXXXXXXXXXXXXNGSCQEQIDLVPRS
PQELYELTSLICELMPCLPKEGIFAVDSMLKKGNAQNTDGAIWQWRDDRGLWHPYNRIDS
RIIEQINEDTGTARAIQRKPNPLANTNTSGYSELKKDDARAQLMKEDPELAKSFIKTLFG
VLYEVYSSSAGPAVRHKCLRAILRIIYFADAELLKDVLKNHAVSSHIASMLSSQDLKIVV
GALQMAEILMQKLPDIFSVYFRREGVMHQVKHLAESESLLTSPPKSCPNGSGSLGSTTSV
SSGTATAASNAAADLGSPSLQHSRDDSLDLSPQGRLSDVLKRKRLPKRGPRRPKYSPPRD
DDKVDNQAKSPTTTQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXEKIKGWIKEQAHKFVERYFSSENMDGSNPALNVLQRLCAATEQLNLQVDGGAEC
LVEIRSIVSESDVSSFEIQHSGFVKQLLLYLTSKSEKDAVSREIRLKRFLHVFFSSPLPG
EEPIGRVEPMGNAPLLALVHKMNNCLSQMEQFPVKVHDFPSGNGTGGXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXERESTDDE
SNPLGRAGIWTKTHTIWYKPVREDEESNKDCVGGKRGRAQTAPTKTSPRNAKKHDELWHX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXVGTGLGPTLEFYALVSQELQRADLGLWRGEEVTLSNPKGSQEGTKYIQNLQGLFALP
FGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFD
IDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFP
NIELKKGGKDTPVTIHNLEEYLRLVIFWALNEGVSRQFDSFRDGFESVFPLSHLQYFYPE
ELDQLLCGSKADTWDAKTLMECCRPDHGYTHDSRAVKFLFEILSSFDNEQQRLFLQFVTG
SPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLPDYSSIEIMREKLLI
AAREGQQSFHLS
Download sequence
Identical sequences ENSSARP00000006037 ENSSARP00000006037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]