SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000006303 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000006303
Domain Number 1 Region: 18-108
Classification Level Classification E-value
Superfamily WWE domain 6.8e-24
Family WWE domain 0.0015
Further Details:      
 
Domain Number 2 Region: 107-184
Classification Level Classification E-value
Superfamily WWE domain 1.1e-22
Family WWE domain 0.001
Further Details:      
 
Domain Number 3 Region: 410-493
Classification Level Classification E-value
Superfamily RING/U-box 1.06e-16
Family RING finger domain, C3HC4 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000006303   Gene: ENSSARG00000006951   Transcript: ENSSART00000006948
Sequence length 622
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_6627:17662:37823:1 gene:ENSSARG00000006951 transcript:ENSSART00000006948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMAPVSSPAQVYTGPVAVAVWEWQDGLGIWHPYSANVCRYIEQQFIQQKGLHFGMGNLA
QSIPLGQADPSLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQLSAPGRGIVWEWLSDDSS
WTPYEASVCDYLEQQMFQGNQLVDLAPLGYNYTVNSATCTQTNKTSSYCRSVRRLTGPPY
PVTSVIAPPGHTGIACSCHQCLGGSGTGPVSGRYRHSMTNLPAYPIPQHSNRTATVFGAH
QAFAPYNKPSLSGARSAPRLNTTNPWTGALPSVGTQPLYRSSLYHLASQHLPPGPSTAST
ASSPRPCCGARCARVPAMPTMPVQVSKLSRVQQALAGVTSTLMSAIGFPVCLSRAPQPAN
PPASRPASKSHSSVKRLRKVSMKGXXXXXXXXXXXXXXXXXXXXXXXXXXDCIICMEKLS
TVSGYSDVTDSKSIGPQAVGRLARCSHTFHLLCLLAMYSNGNKDGSLQCPSCKTIYGEKT
GTQPRGKMEVFQFQMPLPGHEDCGTILIVYNIPHGIQXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXVLQLLKVAWKRRLIFTVGTSSTTGESDTVVWNEIHHKTEMDRNVTGHGYPDPN
YLQNVLAELAAQGVTEDCLEPQ
Download sequence
Identical sequences ENSSARP00000006303 ENSSARP00000006303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]