SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000006609 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000006609
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-37
Family V set domains (antibody variable domain-like) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000006609   Gene: ENSSARG00000007311   Transcript: ENSSART00000007291
Sequence length 93
Comment pep:novel scaffold:COMMON_SHREW1:scaffold_88323:2070:2348:1 gene:ENSSARG00000007311 transcript:ENSSART00000007291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQMTQPPSVSASLGEKVTITCKASQSFSKYYLHWYQQKPGTAPRLLIYGATSLGPDVPSR
FSGSGSGTDYTLTISSFKAEDAATYYCQQSNSF
Download sequence
Identical sequences ENSSARP00000006609 ENSSARP00000006609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]