SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000006817 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000006817
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily Immunoglobulin 4.36e-32
Family V set domains (antibody variable domain-like) 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000006817   Gene: ENSSARG00000007534   Transcript: ENSSART00000007521
Sequence length 90
Comment pep:novel scaffold:COMMON_SHREW1:scaffold_256199:4104:4376:1 gene:ENSSARG00000007534 transcript:ENSSART00000007521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQMTQPPFVSASLGEKVTISCKASQGIGKYVVWYQQKTGKAPRLLIYGATSLGPDVPPRF
IGSGSMTDYTLTISSLELEDIATYYCQQFS
Download sequence
Identical sequences ENSSARP00000006817 ENSSARP00000006817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]