SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000006993 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000006993
Domain Number 1 Region: 347-401
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000388
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSSARP00000006993
Domain Number - Region: 252-318
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0798
Family Fungal lipases 0.093
Further Details:      
 
Domain Number - Region: 1-29
Classification Level Classification E-value
Superfamily WWE domain 0.0824
Family WWE domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000006993   Gene: ENSSARG00000007728   Transcript: ENSSART00000007721
Sequence length 669
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_823:4:32117:1 gene:ENSSARG00000007728 transcript:ENSSART00000007721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WFYCKTVDSRETWVPFDAEDSQQLEEAFGSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXLMVHYQPVASSDEWGSTPTEQGRPRTVKRGVENISVDIHCXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXNDFRSVSLNLLQTHFKKAQENQQIGRVEFLPVNWHSPLHSTGVDV
DLQRITLPSINRLRHFTNDTILDVFFYNSPTYCQTIVNTVASEMNRIYTLFLQRNPDFKG
GVSIAGHSLGSLILFDILTNQKDSLENIDSEKDSPDVITDHGDTLTLEEDLKKLQLSEFY
SVFEKEKVDKEALALCSEKDLQEMGIPLGPRKKILNYFRTRKSSVGINRAIPPPASGMNL
SDTPRDAEGCCGADDTGENYLDVGIGQVSVKYPRLIYKPEIFFAFGSPIGMFLTVRGLKR
IDPNYKFPTCKGFFNIYHPFDPVAYRIEPMVVPGVEFEPMLIPHHKGRKRMHLELREGLS
RMSMDFKNNLLGSLRMAWKSFTRTPDPALPAAEAAEETEVESESSSEKPNEEGAEEAAAK
EEEPPINVGLLNGGQRIDYVLQEKPIESFNEYLFALQSHLCYWESEDTVLLVLKEIYQTQ
GIFLDQPLQ
Download sequence
Identical sequences ENSSARP00000006993 ENSSARP00000006993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]