SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000007702 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000007702
Domain Number 1 Region: 130-330
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.59e-48
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.03
Further Details:      
 
Domain Number 2 Region: 15-104
Classification Level Classification E-value
Superfamily WWE domain 2.35e-17
Family WWE domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000007702   Gene: ENSSARG00000008526   Transcript: ENSSART00000008515
Sequence length 331
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_1774:2976:28713:-1 gene:ENSSARG00000008526 transcript:ENSSART00000008515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHRAEEFLPKRTDNDMDEMDTSDTQWGWFYLAECGKWHMFQPDTNIQCSVSSEDIEQSF
KTNPCGSICFTTSKFSYKIDFAEMKQVNLTTGKQRLIKRAPFSISAFSYICENEAIPMPP
HWENVNTDVPYQLIPLHHQTHEYNEVASLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQ
LKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGALFGKGTYFARDAAYSSRF
CKDDIKHGNTFQIHGVSFQQRRLLRAYKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNL
YDSCVDDTWNPRIFVVFDANQIYPEYLIDFH
Download sequence
Identical sequences ENSSARP00000007702 ENSSARP00000007702 XP_004610498.1.94378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]