SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000007778 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000007778
Domain Number 1 Region: 811-1008
Classification Level Classification E-value
Superfamily Fibronectin type III 3.24e-35
Family Fibronectin type III 0.00000139
Further Details:      
 
Domain Number 2 Region: 296-391
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-21
Family I set domains 0.0076
Further Details:      
 
Domain Number 3 Region: 653-781
Classification Level Classification E-value
Superfamily Fibronectin type III 2.46e-21
Family Fibronectin type III 0.00000304
Further Details:      
 
Domain Number 4 Region: 393-489
Classification Level Classification E-value
Superfamily Fibronectin type III 3.57e-21
Family Fibronectin type III 0.00000188
Further Details:      
 
Domain Number 5 Region: 98-195
Classification Level Classification E-value
Superfamily Immunoglobulin 8.3e-18
Family I set domains 0.043
Further Details:      
 
Domain Number 6 Region: 11-114
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000153
Family I set domains 0.014
Further Details:      
 
Domain Number 7 Region: 250-296
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000486
Family I set domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000007778   Gene: ENSSARG00000008578   Transcript: ENSSART00000008598
Sequence length 1389
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_477:482:124710:1 gene:ENSSARG00000008578 transcript:ENSSART00000008598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASIRTFTPFYFLTEPVDTLSVRGASVILNCSAYSEPSPKIEWKKDGTFLNLVSDDRRQLL
PDGSLFISSVVHSKHNKPDEGYYQCMATVDSLGTIVSRTAKLTIAGLPRFTSQPEPSSVY
AGNSAILNCEVNADLVSFVRWEQNRQPLHLDDRIIKLPSGTLVISNATEGDEGLYRCVVE
SGGPPKYSDEAELKVLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXAGRLALLAGGSLEISELTEDDAGTYFCVAESGNETAEAHAELTVAEPEFLK
QPTNIYAHESMDIVFECEVTGKPTPTVKWVKNGDMVIPSDYFKIVKEHNLQVLGLVKSDE
GFYQCIAENDVGNAQAGAQLIILEHAPAATGPLPSAPRDVVASLVSTRFIKLTWRTPASD
PHGDNLTYSVFYTKEGIARERVENTSRPGEMQVTIQNLMPATVYVFRVVAQNKHGSGESS
APLRVETQPEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDRGTEY
NFRVAALTINGTGPATDWLSAETFESDLDETRVPEVPSSLHVRPLVTSIVVSWTPPENQN
IVVRGYAIGYGIGSPHAQTIRVDYKQRYYTIENLDPNSHYVITLKAFNNVGEGVPLYESA
VTRPHTDTSEVDLFVINAPYTPVPDPTPMMPPVGVQASILSHDTIRITWADNSLPKHQKI
TDSRYYTVRWKTNIPANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTA
HGTTFELVPTSPPKDVTVVSKEGKPRTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDW
VIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPKADSSDKMPNDQA
SGSAGKGSRLPDIGPDYKPPMSGSNSPHGSPTSPLDSNMLLVIIVSVGVITIVAVVIVAV
FCTRRTTSHQKKKRAACKSVNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPNPIM
TDTPIPRNSQDITPVDNSMDSNIHQRRNSYRXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXVVSAHPIHSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXLNHHLHAVKTASIGTLGRSRPPMPVVVPSAHEVQET
TRMLEDSES
Download sequence
Identical sequences ENSSARP00000007778 ENSSARP00000007778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]