SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000009605 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000009605
Domain Number 1 Region: 3993-4348
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.57e-126
Family Hect, E3 ligase catalytic domain 0.0000000371
Further Details:      
 
Domain Number 2 Region: 1602-1665
Classification Level Classification E-value
Superfamily WWE domain 3.79e-17
Family WWE domain 0.0024
Further Details:      
 
Domain Number 3 Region: 1288-1343
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000102
Family UBA domain 0.0061
Further Details:      
 
Domain Number 4 Region: 101-130,259-456,513-625
Classification Level Classification E-value
Superfamily ARM repeat 0.0000157
Family Plakophilin 1 helical region 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000009605   Gene: ENSSARG00000010460   Transcript: ENSSART00000010633
Sequence length 4355
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_848:3093:204245:-1 gene:ENSSARG00000010460 transcript:ENSSART00000010633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PADCRALIDKLKVCNDEQLLLELQQIKTWNIGKCELYHWVDLLDRFDGILSDAGQTVENM
SWMLVCDRPEREQLKMLLLAVLNFTALLIEYSFSRHLYSSIEHLTTLLASSDMQVVLAVL
NLLYVFSKRSNYITRLGSDKRTPLLTRLQHLAESWGGKENGFGLAECCRDLHMMKYSLSA
TTLHFEFYADPGAEVKIEKRTTSNTLHYIHIEQLDKISESPSEIMESLTKMYSIPKDKQM
LLFTHIRLAHGFSNHRKRLQAVQARLHAISILVYSNALQESANSILYNGLIEELVDVLQI
TDKQLMDIKAASLRTLTSIVHLERTPKLSSIIDCTGTASYHGFLPVLVRNCIQAMIDPSM
DPYPHQFATALFSFLYHLASYDAGGEALVSCGMMEALLKVIKFLGDEQDQITFVTRAVRV
VDLITNLDMAAFQSHSGLSIFIYRLEHEVDLCRKECPFVIKPKIQRPSTAQEGEEMETDM
DGVQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVMDGSLPTSLKHIISNAEYYGPSLF
LLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATREVLGSLPNVFSALCLNA
RGLQSFVQCQPFERLFKVLLSPDYLPAMRRRRSSDPLGDTASNLGSAVDELMRHQPTLKT
DATTAIIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXVVGTEERIPIPLMDYILNVMKFVESILSNNTTDDHCQEFVN
QKGLLPLVTILGLPNLPIDFPTSAACQAVAGVCKSILTLSHEPKVLQEGLLQLDSILSSL
EPLHRPIESPGGSVLLRELACAGNVADATLSAQATPLLHALTAAHAYIMMFVHTCRVGQX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESTVLLSLCTPNSLPSGCEFGQADMQKLV
PKDEKAGTSQGGKRSDGEQDGAVGSMDASTQGLLEGIGLDGDTLAPMETDEPTASDSKGK
SKITPAMAARIKQIKPLLSASSRLGRALAELFGLLVKLCVGSPVRQRRSHHAASTTTAPT
PAARSTASALTKLLTKGLSWQPPPYTPTPRFRLTFFICSVGFTSPMLFDERKYPYHLMLQ
KFLCSGGHNALFETFNWALSMGGKVPVAEGLEHLDLPDGTGEFLDAWLMLVEKMVNPTTV
LESPHSLPAKLPGGVHNFPQFSALRFLVVTQKAAFTCIKNLWNRKPLKVYGGRMAESMLA
ILCHILRGEPVIRERLSKEKEGSRGEEDTGQEEGGSRREPQVNQQQLQQLMDMGFTREHA
MEALLNTKTMEQATEYLLTHPPPIMGGVVRDLSMSEEDQMMRAIAMSLGQDIPMDQRAES
PEEVACRKEEEERKAREKQEEEEAKCLEKFQDADPLEQDELHTFTDTMLPGCFHLLDELP
DTVYRVCDLIMTAIKRNGADYRDMILKQVVNQVWEAADVLIKAALPLTTSDTKTVSEWIS
QMATLPQASNLATRILLLTLLFEELKLPCAWVVESSGILNVLIKLLEVVQPCLQAAKEQK
EVQTPKWITPVLLLIDFYEKTAISSKRRSQMTKYLQSNNNNWRWFDDRSGRWCSYSASNN
STIDSAWKSGETSVRFTAGRRRYTVQFTTMVQVNEETGNRRPVMLTLLRVPRLNKNSKNG
SGQELEKTLEESKEMDIKHKEKSNDNPVLESTNTEKETSLEETKVGEILIQGLTEDMVTV
LIRACVSMLGVPVDPDTLHATLRLCLRLTRDHKYAMMFAELKSTRMILNLTQSSGFNGFT
PLVTLLLRHIIEDPCTLRHTMEKVVRSAATSGAGSTTSGVVSGSLGSREINYILRVLGPA
ACRNPDIFTEVANCCIRIALPAPRGSGTASDDEFENLRIKGPNAVQLVKTTPLKPSPLPV
IPDTIKEVIYDMLNALAAYHAPEEAEKSDSKPGGMTQEVGQLLQDMGDDVYQQYRSLTRQ
GSDFYTQSGFSINSQVFAADGTSTENSASVTSQVEASTPDEARDGKKDKEGDRASEEGKQ
KGKGSKPLMPTSTILRLLAELVRSYVGIATLIANYSYTVGQSGLIKEDCSVLAFVLDHLL
PHTQNAEDKDTPALARLFLASLAAAGSGTDAQVALVNEVKAALGRALAMAESTEKHARLQ
AVMCIISTIMESCPSTSSFYSSATAKTQHNGMNNIIRLFLKKGLVNDLARVPHSLDLSSP
NMANTVNAALKPLETLSRIVNQPSSLFGSKSASNKSKAEQDAQGASQDSSNNQQDPXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQEMQVENELEDLIDELLE
RDGGSGNSTIIVSRSGEDESQEDVLMDEAPSNLSQASTLQANREDSMNILDPEDEEEHTQ
EEDSSGSNEDEDDSQDEEEEEEEDEEDDQEDDEGEEGDEDDDDDGSEMELDEDYPDMNAS
PLVRFERFDREDDLIIEFDNMFSSATDIPPSPGNIPTTHPLMVRHADHSSLTLGSGSSTT
RLTQGIGRSQRTLRQLTANTGHTIHVHYPGNRQPNPPLILQRLLGPSAAADILQLSSSLP
LQSRGRARLLVGNDDVHIIARSDDELLDDFFHDQSTATSQAGTLSSIPTALTRWTEECKV
LDAESMHDCVSVVKVPIVNHLEFLRDEELEERREKRRKQLAEEETKLTDKGKEDKENRDQ
SAQCTSSKANDSTEQNLSDGTPMPDGYPTTPSSADTATSESKETLVTLQPSQQQPTLPTP
PALGEIPQELQSTTGEGGSSTQLLMPVESEELPPTRPSGEAETTQMELSPAPTITSLSPE
RAEDSDALTAVSSQLEGSPMDTSSLASCTLEEAVGDTSAAGNSEQPIASSSTPGDAPPVV
TEVQGRGDGSGEPAQPPEDGSPPASSESSSTRDSAVAISGADSRGILEEPLPSTSSEEED
PLAGINLPEGVDPSFLAALPDDIRREVLQNQLGIRPPTRTAPSTNSSAPAVVGNPGVTEV
SPEFLAALPPAIQEEVLAQQRAEQQRRELAQNASSDTPMDPVTFIQTLPSDLRRSVLEDM
EDSVLAVMPPDIAAEAQALRREQEARQRQLMHERLFGHSSTSALSAILRSPAFTSRLSGN
RGVQYTRLAVQRGGTFQMGGSSSHNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXCYHAQARHWVIRSLLSIQRSSESELCIETPKLSSEEKGKKSSKSC
GSSSHENRPLDLLHKMESKSSNQLSWLSVSMDAALGCRTNIFQIQRSGGRKHTEKHASGG
STVHIHPQAAPVVCRHVLDTLIQLAKVFPSHFTQQRTKETNCESDRERGSKQACSPCSSQ
STSSGICTDFWDLLVKLDNMNVSRKGKNSVKSVPVSSGVEGETSPYSLEASPLGQLMNML
SHPVIRRSSLLTEKLLRLLSLISIALPENKVSEAQANTGSGTSSTTVATSATSTTTTTAA
STTSTLPAITSPVTSAPALVAVTAISTITVAASTTVTTPTTATTTVSTSTTTKASKSPAK
VGEGGSSNTDFKMVSSGLTENQLQLSVEVLTSHSCSEEGLEDAANVLLQLSRGDPGTRDT
VLKLLLNGARHLGYTLCKQIGTLLAELREYNLEQQRRTHCETLSPDGLPEEQPQTTKLKG
KMQSRFDMAENVVIVASQKRPLGGRELQLPSMSMLTSKTSTQKFFLRVLQVIIQLRDDTR
RANKKAKQTGRLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSESSQ
SEASVRREESPMDVDQPSPSAQDTQSVGSDGTPQGEKEKEERPPELPLLSEQLXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTHRTVLNQILRQSTTHLA
DGPFAVLVDYIRVLDFDVKRKYFRQELERLDEGLRKEDMAVHVRRDHVFEDSYRELHRKS
PEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSH
CNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLV
YLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGA
IRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQI
QWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSA
HTCFNQLDLPAYESEKLRHMLLLAIQTCSEGFGLA
Download sequence
Identical sequences ENSSARP00000009605 ENSSARP00000009605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]