SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000010203 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000010203
Domain Number 1 Region: 611-801
Classification Level Classification E-value
Superfamily Macro domain-like 1.53e-49
Family Macro domain 0.0000968
Further Details:      
 
Domain Number 2 Region: 829-1009
Classification Level Classification E-value
Superfamily Macro domain-like 1.19e-43
Family Macro domain 0.00017
Further Details:      
 
Domain Number 3 Region: 1442-1622
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.15e-38
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.032
Further Details:      
 
Domain Number 4 Region: 1333-1423
Classification Level Classification E-value
Superfamily WWE domain 1.96e-17
Family WWE domain 0.0068
Further Details:      
 
Domain Number 5 Region: 1023-1076
Classification Level Classification E-value
Superfamily Macro domain-like 0.00000011
Family Macro domain 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSSARP00000010203
Domain Number - Region: 1160-1206
Classification Level Classification E-value
Superfamily Macro domain-like 0.00149
Family Macro domain 0.013
Further Details:      
 
Domain Number - Region: 58-86
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0197
Family Canonical RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000010203   Gene: ENSSARG00000011299   Transcript: ENSSART00000011305
Sequence length 1623
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_5794:4229:38326:1 gene:ENSSARG00000011299 transcript:ENSSART00000011305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLTLLVENVSGLSSGDFHIEIIQDFKVAVVTFHKNLDIMKFIDDCAKHHTVKNLWPRLLE
VTKTIRVENLPSGVEDQNLKEFFENPQIGGGRVLRIECFPEKSTAEAVKFKFLDIILTKK
LEIGNMPLSVFPYYTSLGTALYGKEKPLIKLPAPFRESLDYPLWKFFQKNNHLIEKINDQ
MAHCHCEITWSQINGEVTIRPAATLVNQGRKKIKTWQHDISTVFADLRCKYKISSFKVDT
VVWDAIKNSVENDHLSIEFDTAMELVTLVGRSEDIEDFESQIKDLIENATEKIKREQQSL
REKLLLSSGKYSLLCQSGTLEGVRTEFPEMKMTYDEISQHLCFKGLPADVYKAKCEIQEK
VFSMSQKSIQVPSEIFQFLQQVDCVEFSRSLFIAQKILAIYELQSTTVLLTSCSSEVLVK
AEKQMMSALNYKHIEVERKVLDGQWKGLTSSLHKQHNSQSVIVHQPSEASAKVXXXXXXX
XXXXXXXXXXXXXXXXXXVEKLIEVFLVYYLNEKKTLCEQLKRKNVQVQFNSESNPKRIL
LTGPKSQVGEGMNLFEQARDSVCVRSVQIDKPGARQFFQEKARFYKSEVKMQYGCFIELQ
ENEEKGGGGDGQKCYLRTDVAPGVSLSVHLGDLTRFPVEVMVNAANEDLKHVGGLAAALS
KAAGPELQCDSDRIVKSQGKILPGCATISKAGNLPYGHVIHAVGPRWEKDKAQKCTYTLR
RAVQESLRLAEEHKYRSIAIPAISAGIFGFPLSQCTETIVSAIKEHFHFEWEGHTLKEIC
LVDSTENAAKAFAEAVKTLLKDKLPGAASEPGVPATAARLTEGSWKRQILRTPGGLMVVM
VKGEIQSATTDVIVNSTSSDLDLDHGTLSKTLLKIAGPELQTELYRAEQAVTVGVGTVLQ
TSGCNLPCHHVLHVVLPDWMDGSTSTLKIMEDAIRKCLEITENLSMKTIAFPAIGTGNLG
FPKKVFAELILSEVFKFSSNNQATILQEVHFMVHPKDNENIQAFSDAFAQKTSGKVPSEE
VPQPADAQDFYGKVSSPKMGVHEMKIGPITFQVATGDITKEEADVIVNSTSNTFNLKTXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXRANQDPVKVAGAIIDAIEDFIRKRSVHSIKRVKVVLFQPQLLNT
FYTSMKTKEGSQVSPQKSLMSKVVSFFSISKPSTPKKDPLVLENKTELTVFQVCGENIKN
VENALSWVKDLIIKEQCSFTIEDECIKNFDEKECKELNELQKKLNITISLDHIKSSMEVE
GISRDVIEARNKVELIIKRVRLDIEEEYRADCISEFVEWQYSYHNTFHRFKKMTNLQLED
ARRAKKKKIDIKIKHQTYTVDFATNTATNAKGETLPIQRLTKAEVDIPSHWSDMKQQNAC
VVDLQPTDPEYVTVASHFNQTCSTFVIEKIARIQNLDLWNSYQMKKKTMDAKNGNIINEK
QLFHGTDADSVPHVNKNGFNRSYAGKNAVAFGKGTYFAVNANYSANDTYSRPDANGKKYM
YYVRVLTGIYTVGNSSLIVPPAKNPQNLTDLYDTVTDNVKAPSLFVVFYDYQAYPEYLIT
FRR
Download sequence
Identical sequences ENSSARP00000010203 ENSSARP00000010203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]