SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000010486 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000010486
Domain Number 1 Region: 208-343
Classification Level Classification E-value
Superfamily ADP-ribosylation 8.73e-39
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.018
Further Details:      
 
Domain Number 2 Region: 24-100
Classification Level Classification E-value
Superfamily WWE domain 0.000000000000157
Family WWE domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000010486   Gene: ENSSARG00000011613   Transcript: ENSSART00000011606
Sequence length 351
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_4942:20060:28306:1 gene:ENSSARG00000011613 transcript:ENSSART00000011606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQEFWGDLNGMTVYETTEFDQLRRLSTPASSNVNSIHHTVWKFFCRDHFGWREYPESVVR
LIEEANSRGLKEVRFMMWNSHYILHNSFFRREIKRRPLFRSCFILLPYLXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXKKEYMNRKMFGRDRIINERHLFHGTSQDVVDGICKHN
FDPRVCGKHATMFGQGSYFAKKASYSHNFSKKSSKGVHFMFLAKVLTGRYTMGSHGMRRP
PPVNPGSVTSDLYDSCVDNFFEPQIFVIFNDDQSYPYFVIQYEEVSSTVSV
Download sequence
Identical sequences ENSSARP00000010486 ENSSARP00000010486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]