SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000011418 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000011418
Domain Number 1 Region: 343-438
Classification Level Classification E-value
Superfamily ADP-ribosylation 6.14e-18
Family ADP-ribosylating toxins 0.057
Further Details:      
 
Domain Number 2 Region: 222-312
Classification Level Classification E-value
Superfamily WWE domain 0.00000000000314
Family WWE domain 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSSARP00000011418
Domain Number - Region: 23-46
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00147
Family CCCH zinc finger 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000011418   Gene: ENSSARG00000012642   Transcript: ENSSART00000012643
Sequence length 548
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_379:2801:20416:-1 gene:ENSSARG00000012642 transcript:ENSSART00000012643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ICLHYNKGDGPHGSCTFQKHCIKLHMCQYFLRGQCKFGSSCKRSHDFSSPENLEKLLKMG
LSADLVSKLPDIYRNAYDIKNKNSVSPSEPRTAFQGASXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXKCNKVHFHLPYRWQFLDGSTWKDLDKMEVIEEAYSYPQKDRIMCAES
TNNFHLDILNFHTMMFGSARARRLSTVSSATRPPQFIFTTDGVWYWTDEQGAWQEYGKQG
IEHPVATVNSSDLEKAYQEFCMPGSDAQTAMLKFQAGKHKYELDFKAFVQKNLVYGTVRK
VCRRPKYVSLKDVKGKQTCHVNFQGPKNIPDHWDPSALPDPGFKKILLNSSSEEYQKIWK
LFNQTLPCCSVKKIERIQNLALWEVYQWQKAQMQKRNGDEPVDERQLFHGTASTFVDAIC
QQNFDWRICGLHGTSYGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXTDPTIFVIFEHQAYPEYVIYIAPDRDLRLPQAIPSNFLT
ASIFGGRR
Download sequence
Identical sequences ENSSARP00000011418 ENSSARP00000011418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]