SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000003204 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000003204
Domain Number 1 Region: 19-197
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.9e-72
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000139
Further Details:      
 
Domain Number 2 Region: 192-296
Classification Level Classification E-value
Superfamily E set domains 2.57e-43
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000003204   Gene: ENSSARG00000003535   Transcript: ENSSART00000003537
Sequence length 553
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_5783:1814:10111:-1 gene:ENSSARG00000003535 transcript:ENSSART00000003537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDLMPLIYPVTEPVLAPGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHP
TIKINGYTGPGTVRISLVTKDPPHRAHPHELVGKDCRDGYYEAELCPDRCIHSFQNLGIQ
CVKKRDLEQAISQRIRTDNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDITGRPLRLPPVL
SHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSF
SQADVHRQVAIVFRTPPYADPGLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPQSYPFTPSLSTIK
FEELPPMVYPPGQMPSQTSALAPATAPVLAQAPAPAPAMAPVLAQGPPTATPLLAPGLPL
ATAPPAPRPATAGDGALSEALLQLQFDTDEDLAALLGASTDPAVFTDLASVDNSDFQQLL
SQGVSAPPAAAEPMLMEYPESITRLVTGSQRPPDPAPAPLGAPGLSNGLLPGDEDFSSIA
DMDFSALLSQISS
Download sequence
Identical sequences ENSSARP00000003204 ENSSARP00000003204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]