SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000005973 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000005973
Domain Number 1 Region: 223-470
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.43e-56
Family Protein kinases, catalytic subunit 0.00000000864
Further Details:      
 
Domain Number 2 Region: 122-265
Classification Level Classification E-value
Superfamily SH2 domain 9.02e-39
Family SH2 domain 0.00000144
Further Details:      
 
Domain Number 3 Region: 53-172
Classification Level Classification E-value
Superfamily SH3-domain 4.59e-23
Family SH3-domain 0.0000461
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000005973   Gene: ENSSARG00000006578   Transcript: ENSSART00000006584
Sequence length 470
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_6275:28188:33028:1 gene:ENSSARG00000006578 transcript:ENSSART00000006584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCSCSSNPDDDWMENIDVCENCHYPIVPLDGKATLPLRNDSDVRDALVTYEGSDPPASP
LQDNLVVALHSYEPSHDGDLGFEMGEKLRILEQNGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKSLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDSGGFYISPRITFPGLHELVRHYTNTADGLCTRLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHRKVAVKSLKQGSMSPDAFLAEANLMKQLQHPRL
VRLYAVVTQEPIYIITEYMENDTLLDPQVVGKGLEASPCANWSQPFLLSTGSLVDFLKTS
SGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIED
NEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWFGILLTEIVTHGRIPYP
Download sequence
Identical sequences ENSSARP00000005973 ENSSARP00000005973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]