SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000007909 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000007909
Domain Number 1 Region: 26-81
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.02e-21
Family KRAB domain (Kruppel-associated box) 0.0025
Further Details:      
 
Domain Number 2 Region: 173-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000387
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000007909   Gene: ENSSARG00000008749   Transcript: ENSSART00000008739
Sequence length 268
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_5558:12731:14704:-1 gene:ENSSARG00000008749 transcript:ENSSART00000008739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPPALLLAPRPGHSGPGCHKPVALRFADVAVYFSPEEWGCLRPAQRALYRDVMRETYG
HLGALGFPGPKPALISWMEQENEAWSPAAQDPEEGESLGGARRGETANKKEVEPEEASGA
KGSRRIPGKEPLEETMKRSAASTISKTRTSSQAPRRATWDQAPTPCRGGDAQRRHVCADC
GRRFTYPSLLVSHRRMHSGERPFPCPECGMRFKRKFAVEAHQWIHRSCSGGRRGRRPGIR
AVPGAPVRGDQDPPVLFRHYPDIFEECG
Download sequence
Identical sequences ENSSARP00000007909 ENSSARP00000007909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]