SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000009499 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000009499
Domain Number 1 Region: 189-422
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.05e-57
Family Voltage-gated potassium channels 0.0011
Further Details:      
 
Domain Number 2 Region: 35-144
Classification Level Classification E-value
Superfamily POZ domain 3.4e-31
Family Tetramerization domain of potassium channels 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000009499   Gene: ENSSARG00000010514   Transcript: ENSSART00000010510
Sequence length 906
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_6265:21092:125435:1 gene:ENSSARG00000010514 transcript:ENSSART00000010510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKAPPGLNRKTSRSTLSLPPEPVDIIRSKTCSRRVKINVGGLNHEVLWRTLDRLPRTR
LGKLRDCNTHESLLEVCDDYNLSENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFG
QELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETMREREGEEFDNTCCPDKRKKLW
DLLEKPNSSVAAKILAIVSILFIVLSTIALSLNTLPELQEIDEFGQPKDNPQLAHVEAVC
IAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSVLQFQNVRRVV
QIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDE
DATKFTSIPASFWRATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNF
SEFYKEQKRQEKAIKRREALERAKRNGSIVSMNLKDAFARSMELIDVAVEKTGESANTKD
SXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXTKTQPHAHAGADCQEQPERSAYEEEIEMEEVVCAHDQLAVAHTDIIVDMKSTS
SIDSFTSCATDFTETERSPLPPPSASHLQMRFPPELTGADEHPRARGPPFLARTREKGPA
AGDAPIDVTVNLEAGGSPSGPQGPAHADSASDSPKSSLKGSNPLKSRSLKVNFKENRGGS
APQTPPSTARPLPVTTADFSLAAPQLISTILLEENPAQGERPLLAPEGSAQCQGPSRGLG
ARFPKQKLFPFSSRERRSFTEIDTGEEDDFLELHAASEDKQADSSPNCFAEQPSDARDPL
REEACAGSSPPQDSSHNCRQDIYHAVAEGEKDSGQEGCKMENHLFAPEIHSNPGDTAYCH
TRETSM
Download sequence
Identical sequences ENSSARP00000009499 ENSSARP00000009499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]