SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000009840 from Sorex araneus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000009840
Domain Number 1 Region: 131-353
Classification Level Classification E-value
Superfamily Mitochondrial carrier 2.48e-64
Family Mitochondrial carrier 0.0000886
Further Details:      
 
Domain Number 2 Region: 7-129
Classification Level Classification E-value
Superfamily EF-hand 9.69e-20
Family Calmodulin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000009840   Gene: ENSSARG00000010884   Transcript: ENSSART00000010884
Sequence length 353
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_2633:44406:51865:-1 gene:ENSSARG00000010884 transcript:ENSSART00000010884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GISAEGSDANVGLDLEEFISYLQEREQRLLLLFHSLDRNQDGHIDVSEIQQSFRALGISI
TLEQAEKILHSMDRDGTMTIDWQEWRDHFLHSLENVEDVLHFWKHSTVLDIGECLTVPDE
FSEQEKMTGMWWKQLVSGAVAGAVSRTGTAPLDRLKVFMQVHASKTNKLNILGGLRSMIQ
EGGVRSLWRGNGINVLKIAPESAIKFMAYEQIKRTIRGQQETLRVQERFVAGSLAGATAQ
TIIYPMEVLKTRLTLRRSGQYRGLLDCARRILEREGPHAFYRGYLPNMLGIVPYAGIDLA
VYETLKNHWLQQYSHESANPGILVLLACGTVSSTCGQIASYPLALVRTRMQAQ
Download sequence
Identical sequences ENSSARP00000009840 ENSSARP00000009840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]